SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|271969422|ref|YP_003343618.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271969422|ref|YP_003343618.1|
Domain Number 1 Region: 6-393
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 2.47e-83
Family Gtf glycosyltransferase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|271969422|ref|YP_003343618.1|
Sequence length 407
Comment hypothetical protein [Streptosporangium roseum DSM 43021]
Sequence
MPRRAHIAMVSIPAPGHVNPSLEVIRELAARGHRVTYANDPSFAEVIEGAGAEPVPYAST
LPMNDPDGWPEDTIAQLDVFLNDSISMLPQLRAAYGDDRPDLFLYDIAGYSARILAENWG
IPAMQLSPCYVAWEGYEEDTAPMVEQLKKAPGGAEHYRRFEQWLVDNGITGTDSQAFVGS
PERALALIPRMMQPNADRVDPARITFTGPCLSARTHQEAWTRPESAEKVLLVSLGSAFTN
LPGFYRSCLAAFGDLPGWHVVLQIGKFVDPAELGEIPANVEVHSWVSQLSILEQADAFVT
HAGMGGTQEGLYCGVPMIAVPQGADQFDNADKIVELGAGRRIDAGQATPEALRTALLELT
SDPEVALRLERISAEVRAEGGTTRAADLVERLLETAAPTPEGSLPAA
Download sequence
Identical sequences D2AYT8
479432.Sros_8226 WP_012894605.1.100029 gi|271969422|ref|YP_003343618.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]