SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|271970029|ref|YP_003344225.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271970029|ref|YP_003344225.1|
Domain Number 1 Region: 77-140
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000196
Family NfeD domain-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|271970029|ref|YP_003344225.1|
Sequence length 144
Comment hypothetical protein [Streptosporangium roseum DSM 43021]
Sequence
MDDWVIWLILAVVLGIAEIFTLTTALGLLGGAALFAGLAAVIGLPVPLQLLVFTGALAAG
VFVVRPIARRQLRQTSSKQRFGIQALVGKPAYVVREVTGRDGRVQIGGEEWSARAYDETL
VIPAGAVVDVIEIEGATALVYPRE
Download sequence
Identical sequences D2B7G1
479432.Sros_8849 gi|271970029|ref|YP_003344225.1| WP_012895209.1.100029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]