SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|271963343|ref|YP_003337539.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271963343|ref|YP_003337539.1|
Domain Number 1 Region: 4-420
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.2e-66
Family Gtf glycosyltransferase 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|271963343|ref|YP_003337539.1|
Sequence length 423
Comment macrolide glycosyltransferase [Streptosporangium roseum DSM 43021]
Sequence
MSLTILFMPESAYGPTNNCIGIGDILRKRGHRVVFAAEASWKGKLEALGFEEDLVDLAPP
SEEEQDPGQFWKDFIRDTAPEYRKSTSAQLETVTKPIWEALVDGAKYCEPQLKAIIERVQ
PDVIVEDNVITFPALLTAGKPFVRIVSCNPLEVRGEGVAPVFSGLPADDRSEWDAFRAEY
DRTHRELWTAFNEWVVAQGARPLPELDFIHEGDLNLYVFPEIADYTDARPLDGSWHRLDS
SVRETDGGFELPASLADRDGALVYFSLGSLGSADVSLMQRVIDVLGTTPHRFIVSKGPLH
EEIKLADNMWGAEFVPQTKIIPMADLVITHGGNNTTTEALHFGKPMILLPLFWDQYDNAQ
RIHELGYGVRLATYTFTDEELTGALDRLLGDAGLRERLAAAGEEIRRRDGLRKAADLIEQ
AGA
Download sequence
Identical sequences D2ATC0
WP_012888541.1.100029 479432.Sros_1806 gi|271963343|ref|YP_003337539.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]