SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|271963663|ref|YP_003337859.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271963663|ref|YP_003337859.1|
Domain Number 1 Region: 7-150
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.29e-47
Family Ribonuclease PH domain 1-like 0.000000149
Further Details:      
 
Domain Number 2 Region: 316-510
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.47e-44
Family Ribonuclease PH domain 1-like 0.000000911
Further Details:      
 
Domain Number 3 Region: 151-259
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.31e-27
Family Ribonuclease PH domain 2-like 0.00000478
Further Details:      
 
Domain Number 4 Region: 473-568
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.54e-24
Family Ribonuclease PH domain 2-like 0.0000207
Further Details:      
 
Domain Number 5 Region: 572-683
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 
Domain Number 6 Region: 263-343
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 2.88e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|271963663|ref|YP_003337859.1|
Sequence length 773
Comment polyribonucleotide nucleotidyltransferase [Streptosporangium roseum DSM 43021]
Sequence
MEGVHSSEAVIDNGSFGTRTIRFETGRLARQAAGSAVVYLDDETMVLSATTASKNPKENL
DFFPLTVDVEERMYAAGRIPGSFFRREGRPSEDAILTCRLIDRPLRPSFVKGLRNEIQVV
ATIMALNPDHLYDVVAINAASLSTQLAGLPFSGPIGGVRVALIEGQWVAFPTHSELANAT
FDMVVAGRVLEDGDVAIMMVEAESTRDTLKLVADGAVAPTEETVAQGLEASKPFIKVLCE
AQSKIAKVAAKATAEYPLFLDYQDDVLEAVTGAVKSELAAALTIAGKQERETELDRVKAL
ALEKVGSEFEGREKEISAAFRSLTKKLMRERVISEGVRIDGRGVKDIRQLNAEVHVVPRV
HGSALFERGETQILGITTLNMLRMEQMIDTLNPERTKRYMHNYNFPPYSTGETGRVGSPK
RREIGHGALAERALVPVLPAREEFPYAIRQVSEALGSNGSTSMGSVCASTMALLDAGVPL
KGIVAGIAMGLINEGDQYVTLTDILGAEDAMGDMDFKVAGTKDVITALQLDTKLDGIPAS
VLAAALKQAKGARLAIIDVMQEAIDSPAEMNATAPRIITIKVPVDKIGEVIGPKGKMINQ
IQDDTGAEITIEDDGTIYIGATDGPSAEAARSAINAIANPHMPEVGERYLGTVVKIAAFG
AFISLMPGKDGLLHVSQIRKLHGGKRIENVEDVMNVGEKVQVEIAEIDSRGKLSLVPVEV
IEKEAAAKAEGGTSEEEPAAPAAADDRPREDRPRRTRTRTSGGGSRGGEDRNS
Download sequence
Identical sequences D2AXU5
WP_012888861.1.100029 479432.Sros_2132 gi|271963663|ref|YP_003337859.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]