SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428774731|ref|YP_007166518.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428774731|ref|YP_007166518.1|
Domain Number 1 Region: 586-757
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0000000000000916
Family HD domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428774731|ref|YP_007166518.1|
Sequence length 806
Comment 7TM receptor with intracellular metal dependent phosphohydrolase [Halothece sp. PCC 7418]
Sequence
MAQLNLAPQGDLKLMKHSPSITHRLAHHPRNRLSLQQWLGKQITAIFTSGSWLIFLLAVL
SLTGVVGNRLYNQPQLAIGTKAPETIIAPSQVNIKDDLKTAQKQETARSRLTPILKVDQG
KNEAILRSLNSKLDALSAQREQAGAVLFAPTKQLSESVQVYLRTCSQTAWESLLSNLDST
SPQGQSLSEQAQSQLAQLSEDLSSSEFSQLLSQIEQARQQYRTTLYSTATIHDQETSWLS
STQRRVLLSLSPSDWQTTRTAIEKTARQMLAQGIAPGLPPSVFRSAIPLQLEEKVPASAI
ALSSEILRETLTPNLVEDTPQTERRAEAIASAVDPVMLRVEAGEAIVTSGEVISREQFLL
LDALGLSQRGVSWDGLFLCGMFVTGAIALFWWVKRVVKRQLRRRDQILLILLSVASPLLL
MLGVPYSCLPAVGLLVSSFYGPSLALTQVSLVTGLEVYTLLSGQSVPVAWEALITGAVGG
LLAAGIAGRLRSREELALLGGAIGLVEGAVYLLLGLILNTMGETIWYAMLPDAVIYGLSG
LVWSIVAFGVSPYLERFFDLVTPIRLAELANPNRPLLQRLAIEAPGTFQHTLFVASLAEA
AARELNCNVELVRAGTLYHDIGKMHDPLGFIENQMGCKNKHDEINDPYASAKIIKKHVSE
GLVMARRCGLPKAIQDFIPEHQGTLLISYFYFQAQKESQETVLESDFRYDGPTPQSRETG
IVMLADGCEAALRSLSDVSPEKALAMVNKIIRSRWQDNQLKDANLTRTELKKVAQVFVRV
WQQTNHKRIAYPKAALDAKYSSSLKK
Download sequence
Identical sequences K9Y688
WP_015224182.1.10129 gi|428774731|ref|YP_007166518.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]