SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428774753|ref|YP_007166540.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428774753|ref|YP_007166540.1|
Domain Number 1 Region: 1653-2010
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 4.64e-45
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 2026-2084,2113-2243
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.31e-28
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00016
Further Details:      
 
Domain Number 3 Region: 2359-2528
Classification Level Classification E-value
Superfamily beta-Roll 5.62e-22
Family Serralysin-like metalloprotease, C-terminal domain 0.0019
Further Details:      
 
Domain Number 4 Region: 63-274
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00000000000000235
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.014
Further Details:      
 
Domain Number 5 Region: 1216-1273,1303-1407
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000000000000165
Family YVTN repeat 0.016
Further Details:      
 
Domain Number 6 Region: 178-198,234-270,420-506,557-602,647-737,1207-1270
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000589
Family Quinoprotein alcohol dehydrogenase-like 0.038
Further Details:      
 
Weak hits

Sequence:  gi|428774753|ref|YP_007166540.1|
Domain Number - Region: 951-1084
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0288
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428774753|ref|YP_007166540.1|
Sequence length 2539
Comment 5'-nucleotidase [Halothece sp. PCC 7418]
Sequence
MSDSLVESVAFDIVHTNRELTITTSDHEPLLANFNFTGDDDMAINLNPIGTFTTGVFDEG
AAEIVAYEAGTQSLFVINSDATTVDILDLSDPTNPTRIDQIDATQFGDGANSVAVNNGVI
AVAIEGETVDSNGQVLLFNTSGGEPALVEVGVLPDMVTFTPDGTKVLVANEGEPNDDYTV
DPEGSVSIIDLEAGTVSNADFTAFNDQKEALINRGVRIFGPNATVAQDLEPEYITVTPDS
TTAYVSLQENNALAVVDLETATVQDILPLGFKDHSRGLPTLEQFEISDTVLEANSLLLGN
SDDPSGVPLGGLSGLFFEGVDEDGNLEFITHPDRGPDLGSEDLDGDGENDVRVFALPDFQ
PSLNRFELNPETGEITFTETIGLTRQDGTPLTGLPNLEGDDSGRQGQDAEGNLLDFDPFG
ADMEGVVVNPADGTFWTVDEYRPSIYHFDTDGTLIDRFVPAGTDPNPDDDVTFGSETLPE
DYLSARDNRGFEAVSLDTEEGILYAFIQTPLGTDGTGEFNRDVSDNSQVIRMLGIDPATG
NPVAEYVYLLEKPAFSEGNIDKIGAATFAGDGKFFVVERDSGTEPTSNKVVYEINLSGAT
NLLAEDAPSLPEGTTLEQLNADELADQGIQAVSKTEVTNLPSLGYLPSDKPEGIALLDDG
SLAVLNDNDFEPETKDTSLGIISFNQSNQIDASDEDGINFQNIPSFGMLQPDAIDSFAVD
GQNYIITANEGDARDYDTFSEEVGLDDLLENGLLDLNDDDNPDTETDVASTGETIAELLA
EDRLGELDFTNATGDIDGDGLIEQLYNYGGRSFSILDQFGNLVFDSGDQFEKIIADQIEQ
GILPEIAFNNDNDENEFDARSDAKGPEPEAIVTGMVDDTPYAFIGLERIGGVMVYELSNP
SEPEFIQYINNRNFVDENGEPISVQLEDESLNPAVGDLGPEGFDFIPAEDSPNDQPLLAV
GNEVSGSTTIYSVADMVEEPEPIEAPEPTNELELSVAGRFETGVFDEGAAEIVAYDAGSE
RLFVINSDAVTVDILNLSDPGNPVANPMTEAQQVEDVPDGSATGDYIFTISEDNTLAVRG
TFSGLSSPLFQVGPEEDAEGNPQSAIHIHTGVAGENGPILRNLTVDTFDDGLSGVFSGEF
NLTEEEAELARTEGLYVNLHTENFNSGEIRGQFVQPSIDATSFGDGANSVAVNDGIVAVA
IEAEEIDANGQVVFFDTEGNVINSVEVGILPDMVTFSPDGNTVLVANEGEPSDDYSIDPE
GSVSIIDISDSVENATVTNAGFTDFNDQQAALEESGVRIFGPDATVAQDLEPEYITVNAE
STTAYVSLQENNAFAVVDLNAGEVTDILPLGFKDHSLPENELDASDEDSINFQTIPSLGM
LQPDSIASFEVDGESYIVTANEGDARDYDTFSEEVGLDDLLENELLDLNDDDTPDVETDV
ASTGETIAELLAEDRLGELDFTSATGDTDGDGLIEQLYNYGGRSFSVFDESGNLIFDSGD
DFEKIIADQIQQGILPEIAFNNDNDVNEFDARSDAKGPEPEAIATGVIEGTPYAFIGLER
IGGIMVYNLSDPTSPEFVEYINNRNFVDDNGDPISVQLEDESLNPAAGDLGPEGFDFISA
EESPNGQPLLAVGNEISGSTTIYNIDVAQQETFTLELLHAADQEGAAPAVSDAPNFSAVL
NALREQDLGNDGLEDNTLTLSSGDAFIGGVFFEASEAVYGANGIGDIQIQNELGFSAIAL
GNHEFDFGTETLASLIDGSAGEDPENPDSGTILGSDFTGANFPYLATNLDFSTDENLSPL
EVEGGQPPQPNTVTSSTLIDVNGENIGVLGATTPNLAALSSPGNVGISPSPFNTNPTDAQ
LDALASEIQSEVDLLLADNPDLNKVVLLAHMQQLSIEEALAERLENVDIIVGGGSNTRLF
DENDRPREGDSVQGEYPKFITNAGGTSTAVVNTDGSYKYVGRLVLDFDAEGNIIPESYDA
NVSGAYATDDQGVADLNAGDLVDPEVQQIADEIEAQIIETESNLFGLSDVFLNGNRSGGP
LDGVRTQETNLGNLTADANLAEAQETDPTVVASIKNGGGIRASIGETLVPPGGNEAVRIP
NEEIVIDGELVKPEGGISQTDIVTTLAFNNGLTLLTLTKEELVDVLEHGVSALPEVAGQF
PQIAGVEFSYDPELPSGDRIQEASIVDESGNSIAELVDNGEIVGDATEEFRIVTLGFLAE
PRFDDEGNFISGGDGYPFPNTNTDPEVGAVGNSEVIERVNLVQLTQEGVQTGEATFADDG
TEQDALAEYLAENFPADDDPNTPVFSQEDTPVSEDTRIVNLSLQEPEPEPEPEPEELSFG
GLEADTLEATVDFAGENSLVFAGEGDDAIFAAEGSGGNRIYAGAGDDEIVAGTDDRVFGG
AGNDILEATVGSGNRLSGGVGDDDFFAGSNNRLVGGDGSDRAFFVEGGNNTVTGGADADQ
FWLANGDLPESANIITDFSAGEDVLGIAGVDLEFSDLVIGSSENNTVIATSDQDLAILLG
VQADTISEDNFVFETGTVS
Download sequence
Identical sequences K9Y603
gi|428774753|ref|YP_007166540.1| WP_015224204.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]