SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428774945|ref|YP_007166732.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428774945|ref|YP_007166732.1|
Domain Number 1 Region: 650-759,792-1160
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 1.1e-125
Family B12-dependent (class II) ribonucleotide reductase 0.00039
Further Details:      
 
Domain Number 2 Region: 8-274
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 2.47e-74
Family B12-dependent (class II) ribonucleotide reductase 0.00027
Further Details:      
 
Domain Number 3 Region: 275-364,398-414,617-678
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 9.81e-24
Family Intein (protein splicing domain) 0.034
Further Details:      
 
Domain Number 4 Region: 492-575
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000000000489
Family Intein endonuclease 0.019
Further Details:      
 
Weak hits

Sequence:  gi|428774945|ref|YP_007166732.1|
Domain Number - Region: 402-482
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000446
Family Group I mobile intron endonuclease 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428774945|ref|YP_007166732.1|
Sequence length 1163
Comment ribonucleoside-triphosphate reductase, adenosylcobalamin-dependent [Halothece sp. PCC 7418]
Sequence
MVRELERKQSTNFPENAPVANPVFFRTYSRRTEDGRETWEQVRDRCISGLVKLGQLTAEE
AQLLEKTMTHLKSLPAGRWLWVGGTQWLENPKNYSGAYNCTSTNVVDWRAFGLMMDLAMM
GCGTGAVLEEKYINQLPAIRNYLNISIVNEIGTVLPEARQEETTVRISDPKKVKICIGDS
REGWVQSYQALLELSSNEDLDTTVNIEIDPSHVRPAGEVLKGFGGVANPIKIPELYPRLA
KILNRAQGRKLNAEECCLLIDEAAATVVAGNIRRCLPEYALVHTARGLVAIKDIKVGDRV
QTPLGFRRVVDKFDQGIQDVREIETNGTYPQATENHRMAVLSSANGDYVWKQVGELESGD
RLLHNTKILAGIPTQLPADETSLRPLQSRTAKAISIPDLNPDVAWLIGFTHGDGYVSLGR
NKHNKPYGSINWATDAELAPLIEEKLNRALANFGVSATKQTSENENTVRFVCSSIRLTEY
FFKNIKRPKEPIEIPDFILQGSVETRAAYLAGIMDSDGSVKNRPPHLVCTVYPQFARQIA
SVLSSLGIAGRIKKTIPQKLNWRTRYHVCLPALKGEYNKLIASHAVKGELKVGLKMYGFT
LTGEMMREAYTYSEMQKMGFQGSRKVDSNYERYRVESEVEMDIPVTFKQLGQVFAVQTYD
IEVEDAHCFYCDGYLTHNSAGMRQFDSDSPLLKQNLWQPDAEGNWRIDPDRDALRMANHT
RVYHHQPSLEDCVEAVRSQFYSGEGAIQYAPEAIARGNADLLNTFELKEQFIQAYQLGHG
EKFLRNLLPESPSQRELNHRLERYALNPCGEITGSNFHCNLSEIHLNLIDPENEQEQTEA
FQAGALAVATLLNHQFQEPRYQYSRELDPIVGVSFTGLFDFFVQAFGVEWLRWWEKGRPE
TEAGLVFKQKEQAYLEKWRKIVHETVWDYCDRHNIKRPNRCTTVQPSGTKSLLTGASPGW
HPPKAVRFIRRVTFGKNDPVALACIDYGYSVVPSQSDKDENGNLLKDPFDERCTEWLVEI
PVAVPWADLPGADEVDISKFSVLAQFDFAMQVQKHYVTHNTSATLELREHEIEDLGQAIY
SAIKNNEGYISAALLARFDAYQTFPRLPFEPVDEATYNQLMREVEERRKMDDFHSALLKY
DLGELSEAGPTGCDTDQCMFPLQ
Download sequence
Identical sequences K9Y8U6
gi|428774945|ref|YP_007166732.1| WP_015224396.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]