SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428775066|ref|YP_007166853.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428775066|ref|YP_007166853.1|
Domain Number 1 Region: 2-142
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 9.03e-37
Family N-terminal domain of MutM-like DNA repair proteins 0.0005
Further Details:      
 
Domain Number 2 Region: 137-226
Classification Level Classification E-value
Superfamily S13-like H2TH domain 3.83e-28
Family Middle domain of MutM-like DNA repair proteins 0.00093
Further Details:      
 
Domain Number 3 Region: 226-277
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000274
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428775066|ref|YP_007166853.1|
Sequence length 278
Comment DNA-(apurinic or apyrimidinic site) lyase [Halothece sp. PCC 7418]
Sequence
MPELPEVETVCRGLNQSTSGQVFQGGEVLLERSIAHPASITEFWSGLQDTAIKQWQRRGK
YLLAELSSGGWLGLHLRMSGQLLWVKQSDPVAKHTRVRFFFPEEQELRFIDLRTFGRVWW
VPPQTDPKTIITGLNQLGVEPFSAEFTPAYLQEKLKTRRCAIKTALLDQKIIAGIGNIYA
DEALFLGKIFPLRPANTLQGSEVEQLQQAILSVLKTGIEEGGTTFNSFKNLLGVNGNYMG
RAWVYGREGESCRQCGTTIERYKINGRSSHFCPCCQPE
Download sequence
Identical sequences K9Y738
gi|428775066|ref|YP_007166853.1| WP_015224517.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]