SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428775181|ref|YP_007166968.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428775181|ref|YP_007166968.1|
Domain Number 1 Region: 37-364
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.54e-114
Family TK-like PP module 0.00000000073
Further Details:      
 
Domain Number 2 Region: 370-564
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.81e-63
Family TK-like Pyr module 0.000000252
Further Details:      
 
Domain Number 3 Region: 569-701
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.01e-44
Family Transketolase C-terminal domain-like 0.0000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428775181|ref|YP_007166968.1|
Sequence length 701
Comment transketolase [Halothece sp. PCC 7418]
Sequence
MGTAQISLGSRRKPLKKIFQSTVVTEESIMVAATQSLEQLCINSIRFLAIDAVEKASSGH
PGLPMGAAPMAFVLWDKFLRFNPKNPHWFNRDRFVLSAGHGCMLQYALLYLTGYDSVSLD
DIKQFRQWESKTPGHPENFMTEGVEVTTGPLGQGISNAVGLAAAEAHLAARFNKPDCQIV
DHYTYVIASDGDLMEGVSNEACSLAGHLGLGKLIALYDDNHISIDGETELSFTEDRMKRY
EALGWHTQVIEDGNTDLEGLEKAIANAKAVTDKPSIIGVRTVIGFGSPNKANTHDVHGAA
LGKDEVAATRKELGWEYGEFEVPEDALSHFRKAVDRGAQSEQEWNQLFAEYKGKYPEDAK
NLQQLISGELPAGWEDALPTYTPDDKADATRNQSGAVLNALSPVLPGLVGGSADLAPSNK
TYVKSSGDFQKGAYENRNFRFGVREHGMGAICNAMALHNSGLIPYGATFLIFTDYMRGAI
RLSALSRAGVIWVMTHDSIGVGEDGPTHQPIEQVASLRAIPELAVFRPADGNETSGAYKV
AVERAAGNPHAPTLLALSRQKLPNLQGSSIEKAAKGGYVLSDSNGTPELILIGTGSEVEL
CVNAAEQLRQEGKNVRVVSMPCWELFEEQDAGYKESVLPQVVTKRVAVEAGTTFGWCRYV
GAEGEVIGIDHFGASSPGGVAMKNFGFTTENVVETAKKVLG
Download sequence
Identical sequences K9Y7H5
gi|428775181|ref|YP_007166968.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]