SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428775259|ref|YP_007167046.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428775259|ref|YP_007167046.1|
Domain Number 1 Region: 3-141
Classification Level Classification E-value
Superfamily PR-1-like 2.35e-20
Family PR-1-like 0.0049
Further Details:      
 
Domain Number 2 Region: 310-407
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000235
Family Collagen-binding domain 0.0048
Further Details:      
 
Weak hits

Sequence:  gi|428775259|ref|YP_007167046.1|
Domain Number - Region: 210-236
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 0.0124
Family Hypothetical protein PA1324 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428775259|ref|YP_007167046.1|
Sequence length 414
Comment hypothetical protein PCC7418_0606 [Halothece sp. PCC 7418]
Sequence
MNTYDQQILDLVNQARSNEGLSPLSWNPQLDSAAESHSEDMALRDFVGSHIGSDDSNPSE
RISEAGYSGSPALAGVENIGWGYPTPEAVVQGWMDSDMGHRDAILNPDADEIGVGYYYLE
NDTGNQNWNHYWTVTFGDAGSPPPPNVEPPQDESISVGVAPNYPPYSDTNSFHENLTERV
YSFSLSETRSVNLNLQIDIPILGVGQGIGDDANLYFYEDSNGNGVFDPSDQQLASSLEWR
NSDDGINYQAVAGTYFAQVVSSSMGWDGTLEYTLDLSATPIQPSSQQAPNLVSVPTGFDV
DFEMAHHWRLSNSVGDSDTVDTYAFSVPEYSGSDVYRADISLIGLSNDADLRLIQDQNNN
DIVDLGEVFDFSNNFGTASESITDIPTGDYFLQVYQYSGDTNYDVNFDLNSVIG
Download sequence
Identical sequences K9Y8K8
gi|428775259|ref|YP_007167046.1| WP_015224710.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]