SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428775553|ref|YP_007167340.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428775553|ref|YP_007167340.1|
Domain Number 1 Region: 301-498
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.6e-45
Family Ribonuclease PH domain 1-like 0.00000633
Further Details:      
 
Domain Number 2 Region: 3-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.08e-43
Family Ribonuclease PH domain 1-like 0.0000317
Further Details:      
 
Domain Number 3 Region: 143-230
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.19e-27
Family Ribonuclease PH domain 2-like 0.0022
Further Details:      
 
Domain Number 4 Region: 461-559
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.36e-26
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 5 Region: 568-651
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.37e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 6 Region: 629-707
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.17e-17
Family Cold shock DNA-binding domain-like 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428775553|ref|YP_007167340.1|
Sequence length 719
Comment polyribonucleotide nucleotidyltransferase [Halothece sp. PCC 7418]
Sequence
MMEFQQSISFDGRDIRLTVGRFAPQAGGSVLIECGDTSVLVTATRSSGREGVDFLPLIVD
YEERLYAAGRIPGGFLRREGRPPEKVTLTSRLIDRPLRPLFPQWIRDDIQVVATTLSMDE
LVPPDVLAVTGASIAVICAQIPFYGPMAAVRVGLVGDDFIINPTYDEINNGDLDLVVAGT
PEGVVMVEAGANQLPEQDVIEAIEFGYEAVRDLIEAQQQLMKDQGITIATEEPPKVDPKL
EDFIKSKATEPIKKVLQRFDLDKKGRDDLLDEIKENEIESAIAQLPEDDPLQVMVAEDPK
AISKVFKEVTRSLMRGQIIEDGVRVDGRKLDEVRPVSCDVSILPPRVHGSGLFRRGLTQV
LSLATLGTPGDAQDLADELHPNEEKRYLHHYNFPPYSVGETKPLRSPGRREIGHGALAER
AITPVLPSKEDFPYVLRVVSEVLSSNGSTSMGSVCGSTLALMDAGVPISKPVSGAAMGLI
KEGDQVRVLTDIQGIEDFLGDMDFKVAGTDSGITALQMDMKITGLSLDVVRQAVEQALPA
RIHILEKMMATIDKPKAELSPFAPHLINYKIDPDLIGLVIGPGGKTIKNITEQTGAKVDI
EDSGAMTISASDRDSAIAALNQIKGLTRKISEGDVCLGRVTRIIPIGAFVELMPGKEGMI
HISQLAEYRVGKVEDEVAVGDEVVVKVREIDNKGRLNLTRLNIHPDEAAAARAAVESEE
Download sequence
Identical sequences K9Y856
gi|428775553|ref|YP_007167340.1| WP_015225003.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]