SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428775779|ref|YP_007167566.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428775779|ref|YP_007167566.1|
Domain Number 1 Region: 2-579
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 3.4e-188
Family Prokaryotic type I DNA topoisomerase 0.00000000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428775779|ref|YP_007167566.1|
Sequence length 902
Comment DNA topoisomerase I [Halothece sp. PCC 7418]
Sequence
MPTLVIVESPTKARTIRKYLPNDYRVEASMGHVRDLPSSAKEVPAKIKGESWARLGVNVE
EGFKPVYVVPTDKKKVVRELKAALKEADELILATDEDREGESISWHLKELLNPKVPTKRM
VFHEITQEAIQDALNHCREVNDDLVQAQETRRILDRLYGYTLSPLLWKKVARGLSAGRVQ
SVAVRLIVEKERERRAFKSGSYWDLKATLEKEKSQFEGKLTTLGGKKLATGADFDPKTGK
IAQGRDVVLLNEADANALKDRLSDKQWTVKQVDERPTTRKPSPPFTTSTLQQEANRKLKI
SARDTMRTAQSLYENGYITYMRTDSVHLSEQAISAARSCVTEKYGKEYLSPKPRQYSTKS
KGAQEAHEAIRPAGESFRSPQETGLQGREFALYDLIWKRTVACQMANAKLTQISVQLTVE
DAEFRSSGKRIDFPGFFRAYVEGSDDPEAALEDQEVILPNLQEGDHPDCKKLESLGHETQ
PPARYTEASLVKMLESEGIGRPSTYASIISTIIDRGYVQMRGNALTPTFTAFAVTSLLEQ
YFGELVDPHFTARMEETLDHIATGEADSTPYLEQFYAGERGVNTLVQEKEDEIDPDTAKA
VNLDNIQAKIKIGYFGPYLETENDDGVVKASIPQDLTPADLNPEQVEVLLRQKTEGPDEL
GIHPETGDPIFIKIGRYGPYVELGEATEENKKPKRCSIPKGTKPEDVTLDMAVKLLSLPR
LLGEHPSTGAPVKAAIGPYGPYVVHDQGKEGKDYRSLKKEDDVLTVGLDRALELLAQPKK
SRRGSQKELIKELGNHPDNDKPVKLYKGPHGPYVNHGRKNVGLPEGESPDKITLERAVEL
LAEKSKSKSKSSSSKTTSKSQTGTKKTTTSKKSTTTKSASGKSSGSKSSSSKTKTTRKKK
TE
Download sequence
Identical sequences K9YA52
WP_015225229.1.10129 gi|428775779|ref|YP_007167566.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]