SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428775898|ref|YP_007167685.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428775898|ref|YP_007167685.1|
Domain Number 1 Region: 51-330
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.43e-36
Family TK-like PP module 0.0068
Further Details:      
 
Domain Number 2 Region: 369-575
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.06e-30
Family TK-like Pyr module 0.04
Further Details:      
 
Domain Number 3 Region: 582-731
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000000432
Family Transketolase C-terminal domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428775898|ref|YP_007167685.1|
Sequence length 732
Comment transketolase [Halothece sp. PCC 7418]
Sequence
MTVASAIPAFCQGIQYFAEQLPEFEKYGQAPAIAEGKTQVSSPSDASAVYQTLLGADALR
YLTLQMTASKASGHPGGFASIAEGIAALVMLGHKHIITEVGHHAPGFYSNMFLDRSLEEM
GIENVQHLRDRFREHKGLLGHLSGQIPGLLNPAGPLGQGQHFAMAGARLHPDILFPVTIG
DGGIGEPYVMSSMAHFHTAYPDVTNFLPILVWNGYSQEHHSMVSTKPNQEMIEYWEGNGF
QEVILVNAKDYDDANQSGDYVDSTAFSFAKRLEFTQAVLEATDKAAKSAMSGKLTVLIIK
QLKGAGVHDRGAKAHNLYGYHTLDNEDIVNALQERSLSPEAWQLVRSNFERAAGGPAVSL
VKTEFELPLPDLGQLPLEEHPIGGEKKVATTAMGELIAHVGKQDPNFVLTNADGNAASGI
NNVNQALKIIHPTPDDLYFQGPKGQVYEPLSEDACAGLAASSALFGARTLWCSYESFAIN
GLPIWQTVTQAMAELRRPTPSTITLFTAGALEQGRNGWTHQRPEIENYFAGMMRNGNVFP
LFPCDANSIQVCYDWALGTKNKGVTITASKSPLPIRTTFQQTQDGLEKGGFILQEMPGEK
TVVFAVIGDMTLIPTLEAAEQLQAQGIGSKVISVISPRRLYRPTDTAWDSCAQADGGFLN
DADFNQLFGGEALIGVTGGSSAMLEPVMLRSTAPRDTFAWKRGETAASASAVMAINGITA
ENLVKRAVELLG
Download sequence
Identical sequences K9Y948
gi|428775898|ref|YP_007167685.1| WP_015225347.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]