SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428776026|ref|YP_007167813.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428776026|ref|YP_007167813.1|
Domain Number 1 Region: 12-260
Classification Level Classification E-value
Superfamily PHP domain-like 3.34e-32
Family PHP domain 0.011
Further Details:      
 
Domain Number 2 Region: 785-870
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 5.3e-16
Family Intein (protein splicing domain) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428776026|ref|YP_007167813.1|
Sequence length 894
Comment DNA polymerase III subunit alpha [Halothece sp. PCC 7418]
Sequence
MHQKKGNMSSFVGLHIHSDYSLLDGASQLPPLVDRALELGMSAIALTDHGVMYGAIELIK
ICRSKNIKPIIGNEMYVINTDDLEKPAKYKKYHQVVLAKDTQGYKNLVKLTTVSNLKGIH
GKGIFARPCISKYYLEQYKEGLIVTSGCLGGEVPQAILRGDRKEARRVAKWYKKVFGDDY
YLEIQDHGSPEDRIVNTEIVKISQELDIKIVATNDSHFISCNDVEAHDALICIQTNKLIT
EDKRLRYSGTEYLKSADEMRQLFRDHLSDDVIESAIANTVEVAEKVKPYNILGEPRIPDY
PVPSGHNADTYLEELTWNGLMERLGCRSRSEISETYKTRLERELTIMQERGFSTYFLVVW
DYIKYARDHNIPVGPGRGSAAGSLVAYALKITNIDPVHHGLLFERFLNPERKSMPDIDTD
FCIERRDEVIEYVTRRYGDDKVAQIITFNRMTSKAVLKDVARVLDIPYSESDRLAKMIPV
ARGKPAELTKMISDDTPEPEFKKLYDSDEKVRRWVDMAIRIEGTNKTFGVHAAGVVISKE
PLDEVVPLQKNNDGAVITQYYMEDLEALGLLKMDFLGLKNLTTIQRTADLIEKNKGTKLD
LDELPLDEIHSRKILAKGEIKNTKPPDIQKTYNLIEKGWLEGVFQLESSGMLKVVQDLKP
SSIEDLSSILALYRPGPLDAGLIPKFIDRKHGREEIIYEHPILEPILDETYAVMVYQEQI
MKIAQDMAGYSLGQADLLRRAMGKKKVKEMQKHREIFIDGATKNGVKQETAEHLFDQMIK
FAEYCLSYDTEIWTVEYGAMPIGKIVEEKIECSVYTVDENGFVYTQPIAQWHPRGQQEII
EYTLEDGRKIRATKDHKMMTESGEMLPIEEIFQRELDLKVETFHEMSLLRRGAK
Download sequence
Identical sequences K9Y9Q9
gi|428776026|ref|YP_007167813.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]