SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428776221|ref|YP_007168008.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428776221|ref|YP_007168008.1|
Domain Number 1 Region: 40-216
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.36e-72
Family HD domain 0.00000153
Further Details:      
 
Domain Number 2 Region: 205-421
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.43e-65
Family RelA/SpoT domain 0.0000147
Further Details:      
 
Domain Number 3 Region: 404-477
Classification Level Classification E-value
Superfamily TGS-like 1.54e-21
Family G domain-linked domain 0.068
Further Details:      
 
Domain Number 4 Region: 682-759
Classification Level Classification E-value
Superfamily ACT-like 0.000000000258
Family AF1403 N-terminal domain-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428776221|ref|YP_007168008.1|
Sequence length 765
Comment (p)ppGpp synthetase I SpoT/RelA [Halothece sp. PCC 7418]
Sequence
MDAMSSTRALLYAQKAPTEYNTPLPQWLADCIDIANDPSQDNQDAKLIAEAFQFAYNLHE
GQYRRSGEPYIAHPVAVAGLIRDLGGGSAMIAAGFLHDIVEDTDITCEEIQEKFGEGVRH
LVEGVTKLSKFKFSSKTERQAENFRRMFLAMAKDIRVVVVKLADRLHNMRTLEHLKPEKQ
KQIALETREIFAPLANRLGIGRFKWELEDLSFKYLEPEAFQEIRELVADRRADREARIEN
VIQILHQRFDQAGIEIEELKGRPKHLYGIYQKMQQQQKEFEEIYDLAGVRVILKTREDCY
RALAVIHDAFKPIPGRFKDYIGLPKPNRYQSLHTTVIGTYGKPIEMQIRTMEMHHIAEYG
IAAHWLYKETGGSSDFKPTAEDEKFTWLRQLLEWQNDLKDAQEYMESIRDNLFEDDVFVF
TPQGDVVALSRGATPVDFAYHIHTEVGHHMKGARVNGRWTVLDAPLHNGDIVEIITSKNC
HPSLDWLNFVVTPSARNRIRQWYKRSHREENIARGRSMLEKVIGKSGSDSLMKSERMQRV
AERCNHQSVDDLLAAIGYGEITTNSVASKLREESLQEEQVEKADGIGNLEEETVHSLPTT
TSRQSTSHSYSKSPIAGVEGLMYHRAGCCCPLPGEPIVGVVTRTKGVTIHRQDCSNVENI
DSDRVIPVDWNPINGNGNGRTPTYTVDLEVEVIDRVGVFRDILARLSDQHINVSNASVKT
GKGKPALISLSIEVKDHQQMQYSFNQIKQMSDVLKLRRVNQCSDL
Download sequence
Identical sequences K9YAC2
gi|428776221|ref|YP_007168008.1| WP_015225670.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]