SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428776290|ref|YP_007168077.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428776290|ref|YP_007168077.1|
Domain Number 1 Region: 4-378
Classification Level Classification E-value
Superfamily Citrate synthase 7.46e-139
Family Citrate synthase 0.0000000431
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428776290|ref|YP_007168077.1|
Sequence length 378
Comment citrate synthase [Halothece sp. PCC 7418]
Sequence
MKVCEYQPGLEGIPAARSAISYVNGAEGILEYRGIRIEELATHSNFLETAYLLIWGQLPS
PAELESFQQEVRYHRRIKYRIRDMMKCFPESGHPMDALQASAAALGLFYSRRALDNPEYI
REAVVRLLAKIPTMVAAFQLMRKGNDPVQPRDDLDYANNFLYMLTEREPDPFAARVFDVC
LTLHAEHTINASTFSAMVTASTLTDPYAVMASAVGTLAGPLHGGANEEVIAMLEEIGSVE
NVRPYVESAIENKQKIMGFGHRVYKVKDPRAVILQELAEKLFENVGYDQYYFIALELERV
IEEKLGHKGIYANVDFYSGLVYRHLGIPTDLFTPIFAIARVAGWLAHWKEQLAVNRIFRP
TQDYVGEHNRSYVPIEKR
Download sequence
Identical sequences K9YCN1
WP_015225738.1.10129 gi|428776290|ref|YP_007168077.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]