SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428776474|ref|YP_007168261.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428776474|ref|YP_007168261.1|
Domain Number 1 Region: 62-310
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.51e-27
Family iota-carrageenase 0.082
Further Details:      
 
Weak hits

Sequence:  gi|428776474|ref|YP_007168261.1|
Domain Number - Region: 374-448
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000461
Family Galacturonase 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428776474|ref|YP_007168261.1|
Sequence length 627
Comment hypothetical protein PCC7418_1879 [Halothece sp. PCC 7418]
Sequence
MTNKLIYRSLGLVLISLLSGCASETLYSSPFNSEDDQLLETSQLLDHSPTLPQEKQFPND
IGWINIKQDYGAKGDGKTDDTQAIQKALATPYSSYNRPKLIYFPKGTYLVSDTLQFPAEG
MQCCVTFQGQGRDNTIIKLKDNLPAYRADAAAAVIRTRAGNIAFRNYIRDLTVNTGRGNP
GAVGIDYISNNRGAIKDVTIKSEDGQGRIGLSMLRQWPGPSLIKNVSIEGFDVGIRTFHS
VYGMVFENINLSNQNEVGLQNTSNTIAIRNLKSNNSVPVIHNVGNGLTILLNGEFQGGSS
SVSAINNRAYIYARNVTAQGYQSAIQNWDHIVPDLYHREYIFDRVDSLFDAPKHSLQLPI
EETPVFHDNNLNHWANVKDYPSVQAAMNSGHSTIYFPRGDYPTSGFINIPDTVKKIIGFE
SRLGAPKNEKVVFQITDKSTDPLIIEGFILNERVTIQHASPRTLALKYSQLQGSLLNSKE
AGKLFLEDVQTELHLDYPQQVWARQLNIETLSNPRTKISNNGGNLWILGLKTEGKGSVIE
TTNGGQTELLGTVIYPVRKFTDAEQKTQAAFVNENSNHSLIYSLSAASAQRNYQIQVKEI
RNGETKVFLTEDLPSYQIPLFVGYNNN
Download sequence
Identical sequences K9YC52
WP_015225922.1.10129 gi|428776474|ref|YP_007168261.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]