SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428776627|ref|YP_007168414.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428776627|ref|YP_007168414.1|
Domain Number 1 Region: 349-541
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.13e-50
Family Ppx associated domain 0.00081
Further Details:      
 
Domain Number 2 Region: 152-335
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.13e-41
Family Ppx/GppA phosphatase 0.00088
Further Details:      
 
Domain Number 3 Region: 26-148
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.06e-35
Family Ppx/GppA phosphatase 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428776627|ref|YP_007168414.1|
Sequence length 546
Comment ppx/GppA phosphatase [Halothece sp. PCC 7418]
Sequence
MVNTIYPIQTQSLNAQNSNLKKERVIAAIDIGTNSIHMVIVEIEPSLPAFNIIAREKDTA
RLGDRDPETGRLTVEAMERAMSALERGQELARSFQAEEVVAVATSAVREAPNGREFIKNV
REHLGLTINLISGQEEARRIYLGVLSAMEFNEKPHVIMDIGGGSTELILGDGHEPRCLSS
TKVGAVRLASEFISTDPVSNKELKFLQAYIQGRMERPVEELKAKLAPEELIKFVGTSGTI
ECLATIHANEKFNTTPNPLQGYSFSRKDLEDVVKLLASLNLKERANLPGMSGRRAEIIVP
GAMILLETMKMLDVKDITICERALREGLIVDWMLTHGLIENRLRYQSSVRDRSVIKIAQK
YKVDLESSQRVADFSLDIFDQIQGKLHQWGSQERELLWVAAILHNCGFYISHSAHHKHSY
YLIRYAELLGFTENEIEIIANIARYHRKSKPKKKHTNFQNLPDKTTKKMVSEVSAILRLA
VALDRRQIGAITAVHCNYKEEKQELELELFPKDVNDDCALELWNLDDKKVIFENEYGVKV
IPKLSP
Download sequence
Identical sequences K9YCT9
gi|428776627|ref|YP_007168414.1| WP_015226075.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]