SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428777153|ref|YP_007168940.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428777153|ref|YP_007168940.1|
Domain Number 1 Region: 20-323
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.54e-38
Family Pectate transeliminase 0.078
Further Details:      
 
Domain Number 2 Region: 484-516
Classification Level Classification E-value
Superfamily Sporulation related repeat 0.0000445
Family Sporulation related repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428777153|ref|YP_007168940.1|
Sequence length 518
Comment hypothetical protein PCC7418_2584 [Halothece sp. PCC 7418]
Sequence
MNRLTHPSLSLIIALSSLFPSLVAPAMMNSVHAQTTKTVVYVNPNLGNDQNGKGSRDRPY
QTLTRAIAAAPAQAVIQLADGTYSEETGESFPIIVRKSLEIRGNPNNQGYNVKIKGGGDL
NSPTGAGQNVAMALLANSTLTGVSVTNQRDRGIGVWIEGASPTVFKNTFQQNDNTGVAVN
GRGRAVILNNYFYSNSGNGMVIYGQSQPTVKNNTFERTGFGISITQEASPQLIGNELKHN
RIGIMVEGNAEPILRENLVTLSTEDGLVAIAQSRPNLGTSEEPGRNIFRSNRGNAIKNLT
KTYTIPASGNQITGETAGKVDVSASVAQRAPLPLNRNLSSPVENSSPQPSLGSSREQVWT
APRPFPNNNAPSNQPSPLNLPELDPVPNANTTRRNPSSRNNRARLDDLLVVEPKASPTSR
HPNALPVPSGNIPSGNPFRPGASPQERVRAVGGQYRVVVEIRQASDKTRVKQIVPDAFTS
RYQGRAVMQVGIFRDRANVDEIQQQLQQAGLNVRVISL
Download sequence
Identical sequences K9YCR2
gi|428777153|ref|YP_007168940.1| WP_015226599.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]