SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428777450|ref|YP_007169237.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428777450|ref|YP_007169237.1|
Domain Number 1 Region: 84-611
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 2.33e-137
Family Arylsulfatase 0.00000269
Further Details:      
 
Weak hits

Sequence:  gi|428777450|ref|YP_007169237.1|
Domain Number - Region: 635-769
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00127
Family Clostridium neurotoxins, the second last domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428777450|ref|YP_007169237.1|
Sequence length 797
Comment sulfatase [Halothece sp. PCC 7418]
Sequence
MMKHLFRDCCSKLIVMIALSIALVLTNNLVFSNRAIAAEVSSKSAQTIIQLPKPDPEFKG
KVGKTYKDSVPSYPEPVEAPEGDPNVLIILLDDVGFGMTSTFGGPVPTPNLDKLASNGIS
YNRFHTTALCSPTRAALLTGRNHHSVGTGVIIETGTGYPGYTGIIPKSTALISETLNDNG
YATAMFGKWHNTPEPDISPAGPFNRWPTGLGFDYFYGFNQGEAHQYYPNLYRNTVPVSPS
KTPEEGYHFTADMTDEAIAWTRNVRAADKDKPWFVYFSTGAIHAPHHVPPEWREKFKGQF
NHGWDKQRELTYQKQLEMGIIPEETQLTPRPKEIPAWEEVPEEAKTVYTRLMENYAGYMA
HTDYHIGRLIDALEESGELDNTLIFYIVGDNGASAEGGLEGTFSELASLLGIQLGLESTI
NRLDEIGGPTSEPHVPVGWAWAMDSPFQWTKQVASHFGGTRNPMVVHWPQGIESKGEMRD
QFHHVIDIAPTILEATKIPAPTEVNGIEQKPIEGVSMLYSFDNQKAEDKRTTQYFEMFVN
RGIYDEGWMASTRFGVPWNTATREGDFLDAPWELYNLEEDFSQANDLAEENPAKLQELQA
KFVEEAEKYNVFPLDPRLSERFDPKLRGSGEPPTDWTYYGNDVRLPEPVGPQLFPRGHTI
AADVTIPQEGAEGVITCAGSFSAGWSLYVKDNKPNFRYTVFDIGDVTIPGTVDLPKGKVT
VKSEFTPDGSQKGGGTLKLFVNDKLAGEGKLTRSLFRHGLEPFEVGRDSITAIAPDYQDQ
GKFEFTGQINKVNFALK
Download sequence
Identical sequences K9YG01
WP_015226896.1.10129 gi|428777450|ref|YP_007169237.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]