SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428777465|ref|YP_007169252.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428777465|ref|YP_007169252.1|
Domain Number 1 Region: 98-201
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.0000000903
Family Chaperone J-domain 0.004
Further Details:      
 
Weak hits

Sequence:  gi|428777465|ref|YP_007169252.1|
Domain Number - Region: 219-263
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0183
Family Moesin tail domain 0.015
Further Details:      
 
Domain Number - Region: 46-89
Classification Level Classification E-value
Superfamily PhoU-like 0.034
Family PhoU-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428777465|ref|YP_007169252.1|
Sequence length 343
Comment heat shock protein DnaJ domain-containing protein [Halothece sp. PCC 7418]
Sequence
MSRSRKSKSSQPKSQSLALSEVHDQIAALKKDQQWFLKQIKRKRTELKNLVNQMQEIAQE
MFQRSRPIMEKMMERDREIHQLFQEIFTKRKFGKKSRKKIQSVYESLQSDGLISSPGEDD
ETNPFSEEFAEEFAQAKEGFQEETQDSNQPKEMSDPPANQRKMRDIFLRLASRFHPDKVT
DSETQEQYTAIMQEVNEAYQTGDFAKLLEIESKQHDLTEFAANNDQESNAEKQRSKLMRE
NELLAQQYEEIKQELRYLRQTPEGSAVTDYRRATKEGVDPIADVVAEGEKQLEFMTEIRD
FVRDFRDQKMTIQDFMRGPDLGTAITVEDLEAILDEMFEVEFY
Download sequence
Identical sequences K9YG20
gi|428777465|ref|YP_007169252.1| WP_015226911.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]