SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428777478|ref|YP_007169265.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428777478|ref|YP_007169265.1|
Domain Number 1 Region: 4-91,221-358
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.55e-35
Family Extended AAA-ATPase domain 0.0000907
Further Details:      
 
Domain Number 2 Region: 130-258
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.06e-26
Family Intein (protein splicing domain) 0.0028
Further Details:      
 
Domain Number 3 Region: 374-491
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 7.99e-21
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428777478|ref|YP_007169265.1|
Sequence length 759
Comment DNA polymerase III subunits gamma and tau [Halothece sp. PCC 7418]
Sequence
MSYEPLHQKYRPQTFADLVGQSAIAQTLSNAIDRQRIAPAYLFSGPRGTGKTSSARILAK
SLNCIHSSEPTAQPCGQCEVCRAISNSSALDIIEIDAASNTGVDNIREIIERSSFAPVQC
RYKLYIIDECLTGDTLIRTSQGEMRLDDPNLKGKTVLSYNETTESWEEKKVVRWLQQGVK
ETLQLQTSHSQLQCTENHLLRTEQGWIKAQQLQVGMKLLSPNGVESVEMIQTAGKAAVYD
LEVEDHHNFVANGVLVHNCHMLSTAAFNALLKTLEEPPPRVVFVLATTDPQRVLPTIISR
CQRFDFQRIPLGAMTAHLSAIAQKEAIDITEEALAVIAQVAQGGLRDAQSLLDQLSLLSG
TITIERVWDLVGAIPEQDLIALLQAIKKKNGDQILSRCRQLMDRGREPIIVLENLAGFYR
DLLIAKTAPKQSELVTLTASTWEQLCEIAQQWELSEILTGQRHLQKNEAQIKQTTQPRLW
LEVTLLGLLTSDDQPLALPQSNGHPIQTQASVTPSSAPPQRERVQSSPEPEKTASSPVSP
PVVEKSETPPTPTPAVTGNEAEIWEQLLARLPIPSRALFEQHCRLLAIQDETVQVGVKSQ
QLLDRYAKRRKGDLEKVLTDIFHQQMTVHLQVMTGTTLQSPPQEKSVPPPPERKPEPPPA
EKKETPPEAKQETSSPPTEQNANEPLSVPESTTEQISEEALSAVVQPEESTDESTDAKAL
EKIAKELANAFQGEVMDFDQKDFSFLADVNPDDVEDSEG
Download sequence
Identical sequences K9YDL5
WP_015226924.1.10129 gi|428777478|ref|YP_007169265.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]