SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428777588|ref|YP_007169375.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428777588|ref|YP_007169375.1|
Domain Number 1 Region: 20-169
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.04e-46
Family NQO2-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428777588|ref|YP_007169375.1|
Sequence length 171
Comment NAD(P)-dependent nickel-iron dehydrogenase diaphorase component subunit HoxE [Halothece sp. PCC 7418]
Sequence
MTTATKTTQTEQAPKEKDKRFRVLDVTMKRAQYRQDALIEVLHKAQEAFGYLEEDVLAYV
AKHLKLPLSRVYGVATFYHLFMLKPGGAHTCVVCMGTACYVKGSDKILSNLEKEFKITAG
ETTEDGQVSLVTARCIGACGIAPAIVFDGTVAGQQDTESVSKKLHEWQEEK
Download sequence
Identical sequences K9YDX5 W6AAZ6
WP_015227033.1.10129 gi|428777588|ref|YP_007169375.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]