SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428777925|ref|YP_007169712.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428777925|ref|YP_007169712.1|
Domain Number 1 Region: 305-424
Classification Level Classification E-value
Superfamily Thymidylate synthase-complementing protein Thy1 5.89e-29
Family Thymidylate synthase-complementing protein Thy1 0.002
Further Details:      
 
Domain Number 2 Region: 97-287
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 3.14e-24
Family Intein (protein splicing domain) 0.0011
Further Details:      
 
Domain Number 3 Region: 2-96
Classification Level Classification E-value
Superfamily Thymidylate synthase-complementing protein Thy1 0.0000000000889
Family Thymidylate synthase-complementing protein Thy1 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428777925|ref|YP_007169712.1|
Sequence length 431
Comment thymidylate synthase, flavin-dependent [Halothece sp. PCC 7418]
Sequence
MDKFRIEVIKATPNPQQVMWLAMHQDYSEDLVWDKRDRAPDETKAGEKVIKHLLSGERGH
YGPLEHPQITFNVGFFPHSMMQQIRTHRVGISFDVQCLAGDTEVTFVKASGSLKKAKISE
LYKSWLNKDKENKVQNNNKSQERDFVKNLPLRVLNEETGKFQISRIKDVLCSGVQPVYRL
TLEDSKQLDCTTNHKLLTIQGWQRMGKAVGLVVNSDREVIKTENDCWVLCNGVPILEKTS
AEQIQSQVKAHPVKVAKVEYLGLQTTYDLEVAEPWHNFVANGIVVHNSFRYTGKRLLDVA
EGKRDAEDVFYLRPVGEYTNRQGKRYFYSEEQRQADLEWCIEATKRYQQRIGEGLAEEHA
RGIIPFDTRQHFVMSCNARSLMHLLDLRWKKDAQLEAQKFSELLFGHFQEWTPQLAEWYL
ENRAKKARLSP
Download sequence
Identical sequences K9YHB2
WP_015227370.1.10129 gi|428777925|ref|YP_007169712.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]