SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428777990|ref|YP_007169777.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428777990|ref|YP_007169777.1|
Domain Number 1 Region: 328-449
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.89e-23
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0013
Further Details:      
 
Domain Number 2 Region: 1-55,91-183,212-352
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.36e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428777990|ref|YP_007169777.1|
Sequence length 470
Comment pyridine nucleotide-disulfide oxidoreductase dimerization subunit [Halothece sp. PCC 7418]
Sequence
MNYDVIIIGNTPVGRYAALTAVLWEARVALVTQEISFSAEANWLYNFTLSQLTDITEKCG
SLQPLESQPTAIYQQWTEEVIEIIKEETGLLKLAARGVDVIEGKGEFCRLPQQGFVAKQE
TLKARGYLIATETTSIIPNVPNLSEVGYLTLSDLREKLTLETLPNNLTIIGESPTAISLA
QNLARLNKNITLAITQSRLFPTEDRAMSDLLQSQLEADGITLLKSSPLSHVQQLGQEKWL
QLGKSAIATEELMIIPKTAPNLDKLNLEGVQVSQTQKGLTLNGKLQTTNPSIYACGSVIG
GYSFLNLGQYEAEIALKNILFFPRHTVNYKMIPCLISTHPAFARVGLTETQARRRYGEKV
VVIQEYFKDNLLTIVQSEMTGVLKIIIHEKGQILGGHSFGKNAETLVSIMTMAITRKMKI
KELKTVSFPSPSIAELISKAVRQWDNWYYQNHPFWRELRKRYFLIRRSWT
Download sequence
Identical sequences K9YHI5
WP_015227435.1.10129 gi|428777990|ref|YP_007169777.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]