SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428778257|ref|YP_007170044.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428778257|ref|YP_007170044.1|
Domain Number - Region: 64-140
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000262
Family Collagen-binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428778257|ref|YP_007170044.1|
Sequence length 150
Comment peptidase domain-containing protein [Halothece sp. PCC 7418]
Sequence
MLVSPWKIPLFFGTLLLLLSHEVRPIQAQSNLYNPLILPLNRSISDRLSAKDIPTGEGGF
ARDYQVNLQKGDQVSIDVKSEDFDSIVLLIASDGTTVAENDDGPDGTTNSLLFTRITESG
RYIIRVRAFGQTGGGRFTLKLTRLQPVEEE
Download sequence
Identical sequences K9YHG6
gi|428778257|ref|YP_007170044.1| WP_015227702.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]