SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428778285|ref|YP_007170072.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428778285|ref|YP_007170072.1|
Domain Number 1 Region: 7-65
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 6.09e-16
Family 7-Fe ferredoxin 0.0000757
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428778285|ref|YP_007170072.1|
Sequence length 81
Comment photosystem I iron-sulfur protein PsaC [Halothece sp. PCC 7418]
Sequence
MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAGQIASSPRTEDCIGCKRCETACPT
DFLSVRVYLGAETTRSMGLAY
Download sequence
Identical sequences A0A1D8TPQ3 A0A261KJ44 B5VXY8 D4ZQA8 F4XMV9 H1WCZ0 K1XC22 K9YIC5 K9YUB8 Q119B1
2005370664 gi|428779521|ref|YP_007171307.1| gi|479132815|ref|YP_005072775.1| 203124.Tery_0454 gi|428778285|ref|YP_007170072.1| WP_006616272.1.10129 WP_006616272.1.32468 WP_006616272.1.32502 WP_006616272.1.3704 WP_006616272.1.43450 WP_006616272.1.45429 WP_006616272.1.46202 WP_006616272.1.59116 WP_006616272.1.68527 WP_006616272.1.76044 WP_006616272.1.77122 WP_006616272.1.8022 WP_006616272.1.80319 WP_006616272.1.84087 WP_006616272.1.891 WP_006616272.1.97340 gi|113474325|ref|YP_720386.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]