SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428775221|ref|YP_007167008.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428775221|ref|YP_007167008.1|
Domain Number 1 Region: 795-1174
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.26e-127
Family PFOR PP module 0.0000000126
Further Details:      
 
Domain Number 2 Region: 421-669
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.14e-81
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000385
Further Details:      
 
Domain Number 3 Region: 5-259
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.71e-76
Family PFOR Pyr module 0.0000000681
Further Details:      
 
Domain Number 4 Region: 261-417
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 6.81e-50
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000843
Further Details:      
 
Domain Number 5 Region: 666-839
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.37e-23
Family Ferredoxin domains from multidomain proteins 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428775221|ref|YP_007167008.1|
Sequence length 1180
Comment pyruvate ferredoxin/flavodoxin oxidoreductase [Halothece sp. PCC 7418]
Sequence
MTAKKQTMLDGNEAIARVAYRLNEVIAIYPITPASPMGEWPDAWASQGQPNLWGTVPSVV
EMQSEGGAAGAVHGSLQTGALTTTFTASQGLLLMIPNLYKIAGELSRAVIHVAARSVAAQ
ALSIFGEHSDVMAARGTGFAFLSSASVQEAQDLALIAQAATLKTRIPFLHFCDGFRTSHE
IQKIELLENEDLEAFVDEADIFDHRQLALNPDHPVLRGTAQNPDVFFQARESVNSFYNDC
PAVVQAMMDKFGERTGRQYQLYEYHGAPDADRVVVLMGSGCETAHEAVDYLTAQGEKVGV
LKVRLYRPWDVHRFVESLPETTRAIAVLDRTKEPGSSGEPLYLDVVTAVQEAWTGTLPKV
VGGRYGLSSKEFTPAMVKGVLDNLSQAQPKNHFTIGINDDLTHTSLSYDPEFSTEPETVS
RAVFYGLGSDGTVGANKNSIKIIGSQTENYAQGYFVYDSKKSGAVTVSHLRFGPDPIRST
YLIDQANFVGCHQWSFLEKLDVLEVAADGATFLLNSPYPADQVWEHLPLEVQETIVRKGL
EVYAIDANKVARESGMGGRINTVMQTCFFALSGVLPREEGIAQIKHAIEKTYGKKGTEIV
QMNLSAVDNALDNLHRIDVQTVNSPTHRQPPVPENAPPFVHDVLGKIIARKGDELPVSAL
PCDGTYPTGTAKWEKRGVAQEVPVWEPDVCVQCGKCIMVCPHAVIRGKAYDEGELNNAPS
EFKFTDVKDKAFQGQKFTIQVSPEDCTGCGVCVDVCPAKDKTQPSRKAINMAERLPIRDQ
EQENWDFFLDLPNPDRKQLNVERMRQQQWQEPLFEFSGACAGCGETPYVKLASQLFGDRM
VVANATGCSSIYGGNLPTTPWTQNADGRGPAWSNSLFEDNAEFGFGFRISIDKQADFAKE
LLKKLAGEIGENLVDGILNQEQRSEADIWEQRERVAQLKEKLANLDSPEAKQLLTLADYL
VKKSVWIVGGDGWAYDIGFGGLDHVLASGRDVNILVMDTEVYSNTGGQASKATPRAAVAK
FAAGGKPTAKKDLGAIAMTYGNVYVGSVAMGARDEHTLKVFLEAEAYPGPSLILAYSHCI
AHGINMKTAMGHQKDLVDSGRWLLYRYNPDLIAEGKNPLHMDSRAPKKPVKLSMYKENRF
QMLNKSDPEAAKQLLQDAQSDVEARWQRYQQLASQGGSDQ
Download sequence
Identical sequences K9Y7K8
WP_015224672.1.10129 gi|428775221|ref|YP_007167008.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]