SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428775362|ref|YP_007167149.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428775362|ref|YP_007167149.1|
Domain Number 1 Region: 200-365
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.96e-41
Family Histidine kinase 0.0016
Further Details:      
 
Domain Number 2 Region: 2-89
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.96e-26
Family KaiB-like 0.00067
Further Details:      
 
Domain Number 3 Region: 124-207
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000451
Family Homodimeric domain of signal transducing histidine kinase 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428775362|ref|YP_007167149.1|
Sequence length 366
Comment histidine kinase [Halothece sp. PCC 7418]
Sequence
MPLQLLLFIDERSSSQEHIQGIKSYLQALKDDYPFELQMINVAEQPHLAEHFRLVATPAL
VKITPTPRQTIAGTNLVAQLEQSWPSWVESAQQESSEEAEDASSTNESVTYSTELIRLSD
EIFRLKQENQELNEQIKFKDQVLAMLAHDLRNPLTAASIAMETLELTDQNPDPQRVEKIK
KQIFKQAQTQFRIMNRMITDILQTARGKNAELQIHPQKLNLQTLGNDILEQFEETFARKS
LQLKKDLPQDVPDAHADQELIRQVWVNLLDNAVKYTPDEGTIKVSILHRTSQKIQVTVCD
DGPGIPPEQREQIFEGHVRLKRDEAKEGYGLGLSLCRQVVRAHYGQIWVDSDANRGSCFH
FTLPVY
Download sequence
Identical sequences K9Y940
gi|428775362|ref|YP_007167149.1| WP_015224813.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]