SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428776650|ref|YP_007168437.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428776650|ref|YP_007168437.1|
Domain Number 1 Region: 2712-2810
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000136
Family Cadherin 0.0036
Further Details:      
 
Domain Number 2 Region: 1916-2030
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000327
Family Collagen-binding domain 0.0044
Further Details:      
 
Domain Number 3 Region: 952-1065
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000017
Family Collagen-binding domain 0.0093
Further Details:      
 
Domain Number 4 Region: 1789-1904
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000128
Family Collagen-binding domain 0.0085
Further Details:      
 
Domain Number 5 Region: 1324-1434
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000183
Family Collagen-binding domain 0.011
Further Details:      
 
Domain Number 6 Region: 1077-1191
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000209
Family Collagen-binding domain 0.011
Further Details:      
 
Weak hits

Sequence:  gi|428776650|ref|YP_007168437.1|
Domain Number - Region: 677-797
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000288
Family Collagen-binding domain 0.0092
Further Details:      
 
Domain Number - Region: 1679-1777
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00183
Family Collagen-binding domain 0.008
Further Details:      
 
Domain Number - Region: 428-544
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00235
Family Collagen-binding domain 0.0078
Further Details:      
 
Domain Number - Region: 305-417
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0183
Family Collagen-binding domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428776650|ref|YP_007168437.1|
Sequence length 2973
Comment peptidase C11 clostripain [Halothece sp. PCC 7418]
Sequence
MKVQWEKIENSTIFSRRDLIEKVIFQTSTLLTEFAQSNQFTSVFEASFGHDNPETVERLR
SAFLSNRFLEELKIEILPSSRLGGALGAYASAINTIYLSQELLFSSYEKVASVLLEEIGH
SIDAQIRRSDSCGDEGAIFAILVQGKALSERQLRDLKTEGDTVTVQIDGQTLELEQQNYD
LGSLQGVNGYSDTLYWGDAEDYYTFSIGGTGRTSSQVEIATTSTAVNLVLELYDPSTGQL
LYDPNGIPYISDVNNNSYNYEALSLTSFAPGSYTARVYDAFGGQYVSPYLASYNLTITAP
SATDGTEFNDWYTQATILDTTDGEEYLTGLAIDDPTDVDWYYFTTTELSTWDHFAQINFN
HAAGNLAVALWDEYGGYYPVDTYNDSEFIYLAGLPAGNYYLQVGSFVGHANPNYELIIST
PKPLPPDEFDATNANNNWSSASPLGEVGGVYSQSDLSLHSASDQDWLKFETNAIGTFEDY
IAINFESWKGDLALALYDDQGYFLNYSDYYGSNQEALPLAGLPAGTYYAQIYSYSDQTNN
YDLEISAPGATTQLSPDRFETNNSRSEAQALEELQGLQWWQGLSIHETADEDWFQFDLER
EGTRENFAAITFTTVEGDLDLKLYDSAGNFLKDSTGFRNFEKISLQGQKLGYLQVVGYEG
ATNPNYNLLINAPGETDNDTAQKATPLSQIQGLKIYDELSISHENDIDWYRFSIANTGNG
NNFVRIDFSAVEGDLNLALYEYTGTTNQEAGLEENTFDPNNLLLVEKSEKTTSPEEISLE
TLEAGEYFIQVYGFDEDDLSPYTFTIDAPTETGADSFDDSADNNTRSRATDLNSLVKPGQ
TTLSLPETSQQSLSIHQASDEDWFKFELATQGKESNFAAIAFDHTLGDLDLELYNDSGIK
IDESTGVADLHEIDLAGQAASFYTLRISGYNGATNPEYSLTINAPLQQPTGDNYESNDSR
EEAKPLGFGVNRIPNLSISQSGDVDWFEFELSDKGNFSNVAGIDFTHGEGDLDLVLYDNS
GEEVKRSQGVANTEEISLAGLASGTYYLKVFRFDEAEAETDYQLYYDLPQDDSEDWSETN
DTLDTAFDLRNVEGLQTWDALSIHTSEDEDWFKFNLIGNADANDFVSLIFDNTLGDLDLF
LYDAAGTNLLESSETATNFEQLSLKGYEGGTYLLKVEGHNSSTNPNYQLVINAPTFEELK
DWAEPNDTQDDAENLQTVQGTQVWSGLSLENNTDIDWFKFTTIGEGVTGHAVSIEFDHSE
GNLDLRLIDPNGNEYTSTSNSDRERISLAERPAGEYWVKVEGEANSNYSVVIDAPQEAEA
DWAEDNDTQSKAEDLRDIQGSLVLNGFSIHPANDQDWFKFNLDKPPVAGQIVRIDFNHYE
GDLNLEVIDPTGNRFTSTTTKNFEEIALAGKEAGTYYVKVTGVDGATNPEYRLTVVGTPE
AKPDDLEPNDHPNEAYELRNIEQSSSNERFGSGFSFPNNGATPSYNFLNSSNYQQADAWL
NYGSSLGLNYPTSSGSGFSFPNNGATPSYNFLNSSNYQQADAWLNYGSSLGLNYPTSSGS
GFSFPNNGATPSYNFLNSSNYQQADAWLNYGSSLGLNYPTSSGSGFSFPNNGATPSYNFL
NSSNYQQADAWLNYGNQILSPYHQQIGSLVGSTGISPLDLYLGGKTSATQFRFSLPNLSI
HSVEDEDWFKFTLNQDGQEQQLIELSFDHDLGDLQLDLFESFDAHSISSNEYDQYLVERT
NSRSDNEIITLANLAAGEYYVKVSGVNDATHPSYTLTLSAPPSLDETGDWTEPNNNNNQA
YDLREVEGSRILSDLSIHNETDTDWFQFETTGEGKEGHVVRIDFNDEQGDLDLILYNENG
TEEIARSESTDNSEEISLDGLATGTYQLQVLGYEEATNPNYTFSVFAPDTSINPDNLEPN
DDFDNATLLGQNGNISSLSGLTIHPDDSDFFKFTTTSPSTVGNSLSIEFEHAQGDLQLEL
YEEGSTTPLQTSQSTTNNETISLAELEAGTYYAKVVGNSDSIANNYQLHLDAPLEEAEAT
AQNDWTIMVYMTASDLAPFAFEDINEMEFAASQLPSTVNFAVLWDQSQTYTQEYDNGYTY
TFHPYPTGNLAAWGDTGRGIIQSDTNFESVVTSFERIGEQNTGDSQTLVDFVNWAKDAAP
AENYALVMWDHGSGDLFGFNGDDEGNPNNPNKDSMYIDELVSALDSFQNSDNFTFDLISF
DACLMAMTEVGYALSDYTDIFVASQENEGGKGYDYTTAFSVLGANPDQVTTEGLATGIVS
SYQQQYVPQNTENDTHSASQVNQFDQLVTSLDHFTDTILESATASDWTGLYDARQAATSF
GSNPTGFSFEFYRDLGQFVGAIASSNNITTSISEAAQAVSSALQNTIVAQTSDRRDTKGL
SVFLPADNILSNAVVQEYLSRNQAFFENTGWLDFVDAFLANEPTDRNNFLTDWAEANNVS
ARGHNLHTLIGDGHEFADLNLHDPSDQDWFRFTTNEAGITGDKVAVTYDRASGEDLSLLL
RYTDHEGQIQERTATETDTGQEISLEGLPNGEYRILVKAEDSIIPEYFLIIDAPGTPTDG
KDWARGNNSFNKAEEVGVITAQTQLSGLQVDSSSADWFEFELPKVNSEQIQPIQITVDIP
GSSTVKAELFNADDTMTSISSTVGTDELQLTAPNPVPGQVYQLQISQESSEDATAYALFF
EPSPQAATDNEPPVFEDIPFSFEVNINQPDQFSATPAASDPEGEDITYSFIGDGNDPDGN
GTDAFAIDESSGAITIAHAAELEGQDIFNLTVQASDGELENTAYVTINVTTLTEVNFDID
GDGEVSALTDGILVIRFLAGFTGEALISGAVASEGATRNTAEEIESYLESAQTMLDVDGN
GTDSALTDGILAIRSFAGFTGEALINGAVGEGATRSEAKAILNHIQIFLPLEEETMVSES
SFSSANLINEPFSSSLMMGGETDLDTGNELILI
Download sequence
Identical sequences K9YDT3
WP_015226098.1.10129 gi|428776650|ref|YP_007168437.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]