SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|262395574|ref|YP_003287427.1| from Vibrio sp. Ex25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262395574|ref|YP_003287427.1|
Domain Number 1 Region: 211-507
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.03e-82
Family Thermolysin-like 0.00000000897
Further Details:      
 
Domain Number 2 Region: 524-619
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000301
Family Collagen-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|262395574|ref|YP_003287427.1|
Sequence length 701
Comment neutral protease precursor [Vibrio sp. Ex25]
Sequence
MGSVSNYQSRLFVTAMLASPLLFSTSLSAAQSERLEQNHGLVVALEKRNLAATQNIDRVL
GLQNGNRVQKLKTNKGKNGGTHSRYQQMFKGVPIWGKQIVVHRDKQGQIKHINGTLVKDI
ARDINDMVPRLSLSQVMSSTQKPYRENGYQIENQRQGLRIYVDKSDVAHLAYIVQFFADN
EHGGKPTRPTFLVDAKTGNILLQYEGLAYVEANGPGGNQKIGRYHYGVDFESLLVQQSGD
TCLMDIPGVVKTINLNGRTSGNTHTFVCPTNSVKEINGAYSPLNDAHYFGKVVYDMYKDW
LNTAPLTFQLQMRVHYRKRYENAFWNGSSMTFGDGASYFYPLVSLDVSAHEVSHGFTEQN
SDLIYSEQSGGINEAFSDMAGEAAEFYSRGSNDWKVGYDIRKAANAALRYMDNPPLDGRS
IDHASQYVSGMDVHYSSGVFNKAFYLLAVEYNWGTRQAFEVFAYANQNYWTPSETFDSAA
AGVLAAAQSLNVAANDVADAFAQVGVSVDGGVVEPPSSTCEAIALNNGVSSNIDSSSTGE
WHCFTIDVPTNSSDFTVTTSGANGDADLYVKLGSEPSLTSYDCRSYSSNSNEACSITSPN
EGTWHIGVYAYSSYSNLNVEASYVGQEAPPPSDEVTTQSINNGKTWTAIITGSGLMNGVW
NVISNTPCDNDNECSLSGIGKKTSEVSFTLTDGTVFIIAKP
Download sequence
Identical sequences WP_012842325.1.43605 WP_012842325.1.82618 150340.VEA_000274 gi|262395574|ref|YP_003287427.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]