SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170762218|ref|YP_001752464.1| from Ureaplasma parvum serovar 3 str. ATCC 27815

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170762218|ref|YP_001752464.1|
Domain Number 1 Region: 14-96
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 4.32e-23
Family GIY-YIG endonuclease 0.005
Further Details:      
 
Domain Number 2 Region: 95-150
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000902
Family Glycosyl hydrolase family 7 catalytic core 0.014
Further Details:      
 
Domain Number 3 Region: 513-568
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.000000921
Family Excinuclease UvrC C-terminal domain 0.031
Further Details:      
 
Weak hits

Sequence:  gi|170762218|ref|YP_001752464.1|
Domain Number - Region: 178-227
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.017
Family C-terminal UvrC-binding domain of UvrB 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170762218|ref|YP_001752464.1|
Sequence length 584
Comment excinuclease ABC subunit C [Ureaplasma parvum serovar 3 str. ATCC 27815]
Sequence
MNDLLKNKLKLIPHKPGCYLWKDQFNQIIYIGKAKDLYNRTHSYFNGCKDNKTSKLVNNI
NDLEYIVVNNVNEALILENNLIKTHLPKYNILLKDGSNYPYIMITNEQYPRLKYVRTYDK
NKGIYFGPLADSTNKYQLFNLLNSIFPFNKCNHQPYKKCIYYDLHQCINQVQQSTYQEAI
SEVKEIFKGNLDHILMILQTKEQHAVTKLDFENAQKYAEQQKALTSIINSGLVQLDNNES
FDIIGFYEKNNYLVIIIFNYVKGKLLNKSADTFAIYDYEINELITSFLMQYYSQNKISSK
IIVSLDDDNLLALSQRFHTKFINAQTKFHKRILKLALDNAILYFESNIKNVINKQNELDD
ALNQLKQILKLPDLNIIECFDNSNINLSLPIAGMIVYQNGKLNNKLNRKYNLMTTKNASD
YHFMIEVITRRYQRLVSQHQKLPNLIVVDGGKLQVNAALYALAQLQINIPLIGLKKDQKH
KTDAIVLTNGDEIVLDRKSILYKFLANMQNDVHNYAISFLRDKHTKSIFNSLLDNVQGLG
KKRFNELLKYYDSINDLKSASDQELLQFLPKNVLVNLREKLNKI
Download sequence
Identical sequences B1AJ20 Q9PQA9
gi|13357942|ref|NP_078216.1| WP_010891756.1.13444 WP_010891756.1.15075 WP_010891756.1.72504 WP_010891756.1.74768 gi|170762218|ref|YP_001752464.1| 273119.UU381 505682.UPA3_0397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]