SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428299892|ref|YP_007138198.1| from Calothrix parietina Calothrix sp. PCC 6303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428299892|ref|YP_007138198.1|
Domain Number 1 Region: 528-803
Classification Level Classification E-value
Superfamily Subtilisin-like 7.59e-86
Family Subtilases 0.00000225
Further Details:      
 
Domain Number 2 Region: 124-253
Classification Level Classification E-value
Superfamily PR-1-like 9.42e-25
Family PR-1-like 0.0028
Further Details:      
 
Domain Number 3 Region: 17-120
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000157
Family Collagen-binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428299892|ref|YP_007138198.1|
Sequence length 897
Comment subtilisin [Calothrix sp. PCC 6303]
Sequence
MTLDNAGNTLGAARKLNLTSTTQTFTDFVGASDLNDIYSFSLSSRLSLNLAVSGLSANAD
VQIIQDKNFNGVFDVSREVITSSYLTGTSNESIKTALDAGNYFIRVFPGAGANTNYNLGV
SAASFSDRVLELTNAERAKVGLSALKLNSQLNQAAQSHSQDMALRDYYSHTGANGSRFSD
RISATGYKFSAAAENIAAGYVTPEDVVQGWMNSSGHKANILNANYKDIGIGHYYLANDRG
AVNYNNYWTQNFGVSSQPVNTVPTALQFGLEKTAYTNTETLKISNGWVFDGNGATDINRV
DFKIKRANGTFVDTADIFSTTPATSDNRWGQFNYSLNLAGLNLATGNYSLWAVAYDKAGA
LSNVFERQFNLTVPNAVPNNLLFGLEKIAYTNTETLRINNGWVFDANGATDINRVDFKIK
RADGTFLDTVDIFSVTSATWDNRWGQFNYGLNLAGLNLASGNHSLWAVAYDKAGAVSNVV
EQKFSLVPPPTSTYNSTSGYGLINAAAAVAKAIGQNTFADVTNLGGNDWGADLVKAPEVW
AKGYTGKGIVVAVLDTGVDYNHTDLKGNIWTNSREIIGNGKDDDGNGFVDDVYGWNFHDK
NNKTLDTHGHGTHVAGTIAGVRNNFGVTGIAYDAKIMSVKVLGNEGGSSLSVAGGIRYAV
NNGANVINMSLGSNSPSSDILAALQYASSKGVIVVMAAGNDRLTLPGFPARYADKWGIAV
GAVDRNNNMASFSNRAGSNPLAYVTAPGVSIYSTIPGNGYSFMSGTSMAAPHVAGVVALM
LSANRSLSDSRVREIVTQSAFNGQNSAFVTNNALSTSTVNTKTSLAYSINQNTFSSTTPK
IVNLKTDLNAVYSFKEGNMFANPINWLQSTSFYQKIQLESAANPQTILNLDKKHLLQ
Download sequence
Identical sequences K9V2Z3
gi|428299892|ref|YP_007138198.1| WP_015198854.1.40975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]