SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|169834607|ref|YP_001693307.1| from Clostridium botulinum B1 str. Okra

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169834607|ref|YP_001693307.1|
Domain Number 1 Region: 2-533
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.31e-208
Family Clostridium neurotoxins, catalytic domain 0.00000000000000157
Further Details:      
 
Domain Number 2 Region: 536-861
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 3.79e-126
Family Clostridium neurotoxins, "coiled-coil" domain 0.00000000000831
Further Details:      
 
Domain Number 3 Region: 1082-1291
Classification Level Classification E-value
Superfamily STI-like 9.98e-82
Family Clostridium neurotoxins, C-terminal domain 0.00000000133
Further Details:      
 
Domain Number 4 Region: 860-1066
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.75e-46
Family Clostridium neurotoxins, the second last domain 0.00000000347
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|169834607|ref|YP_001693307.1|
Sequence length 1291
Comment botulinum neurotoxin type B [Clostridium botulinum B1 str. Okra]
Sequence
MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERYTFGYKPEDFN
KSSGIFNRDVCEYYDPDYLNTNDKKNIFLQTMIKLFNRIKSKPLGEKLLEMIINGIPYLG
DRRVPLEEFNTNIASVTVNKLISNPGEVERKKGIFANLIIFGPGPVLNENETIDIGIQNH
FASREGFGGIMQMKFCPEYVSVFNNVQENKGASIFNRRGYFSDPALILMHELIHVLHGLY
GIKVDDLPIVPNEKKFFMQSTDAIQAEELYTFGGQDPSIITPSTDKSIYDKVLQNFRGIV
DRLNKVLVCISDPNININIYKNKFKDKYKFVEDSEGKYSIDVESFDKLYKSLMFGFTETN
IAENYKIKTRASYFSDSLPPVKIKNLLDNEIYTIEEGFNISDKDMEKEYRGQNKAINKQA
YEEISKEHLAVYKIQMCKSVKAPGICIDVDNEDLFFIADKNSFSDDLSKNERIEYNTQSN
YIENDFPINELILDTDLISKIELPSENTESLTDFNVDVPVYEKQPAIKKIFTDENTIFQY
LYSQTFPLDIRDISLTSSFDDALLFSNKVYSFFSMDYIKTANKVVEAGLFAGWVKQIVND
FVIEANKSNTMDKIADISLIVPYIGLALNVGNETAKGNFENAFEIAGASILLEFIPELLI
PVVGAFLLESYIDNKNKIIKTIDNALTKRNEKWSDMYGLIVAQWLSTVNTQFYTIKEGMY
KALNYQAQALEEIIKYRYNIYSEKEKSNINIDFNDINSKLNEGINQAIDNINNFINGCSV
SYLMKKMIPLAVEKLLDFDNTLKKNLLNYIDENKLYLIGSAEYEKSKVNKYLKTIMPFDL
SIYTNDTILIEMFNKYNSEILNNIILNLRYKDNNLIDLSGYGAKVEVYDGVELNDKNQFK
LTSSANSKIRVTQNQNIIFNSVFLDFSVSFWIRIPKYKNDGIQNYIHNEYTIINCMKNNS
GWKISIRGNRIIWTLIDINGKTKSVFFEYNIREDISEYINRWFFVTITNNLNNAKIYING
KLESNTDIKDIREVIANGEIIFKLDGDIDRTQFIWMKYFSIFNTELSQSNIEERYKIQSY
SEYLKDFWGNPLMYNKEYYMFNAGNKNSYIKLKKDSPVGEILTRSKYNQNSKYINYRDLY
IGEKFIIRRKSNSQSINDDIVRKEDYIYLDFFNLNQEWRVYTYKYFKKEEEKLFLAPISD
SDEFYNTIQIKEYDEQPTYSCQLLFKKDEESTDEIGLIGIHRFYESGIVFEEYKDYFCIS
KWYLKEVKRKPYNLKLGCNWQFIPKDEGWTE
Download sequence
Identical sequences B1INP5 P10844 Q33CP3
gi|169834607|ref|YP_001693307.1|NC_010379 gi|169834607|ref|YP_001693307.1| 498213.CLD_A0068 WP_012291519.1.21789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]