SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|171184542|ref|YP_001793461.1| from Thermoproteus neutrophilus V24Sta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171184542|ref|YP_001793461.1|
Domain Number 1 Region: 60-147
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.55e-17
Family FHA domain 0.0022
Further Details:      
 
Weak hits

Sequence:  gi|171184542|ref|YP_001793461.1|
Domain Number - Region: 3-29
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00144
Family Ran binding protein zinc finger-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171184542|ref|YP_001793461.1|
Sequence length 150
Comment FHA domain-containing protein [Pyrobaculum neutrophilum V24Sta]
Sequence
MPWKCPVCGAENRDEDLTCKICGAYKPEATTKKVAQIPRETATAVLAVEVLESPVESLVG
KRFEFRVNSPGVIVTVGRAVDNQIVVPDPAVSRRHMRLIATAGGVVVEDLGSSNGTYLVE
GGGERLIKVESVGKQAVVRIGNTRLRVALV
Download sequence
Identical sequences B1YA41
444157.Tneu_0057 gi|171184542|ref|YP_001793461.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]