SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171184610|ref|YP_001793529.1| from Thermoproteus neutrophilus V24Sta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171184610|ref|YP_001793529.1|
Domain Number 1 Region: 335-374
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000523
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171184610|ref|YP_001793529.1|
Sequence length 415
Comment hypothetical protein Tneu_0126 [Pyrobaculum neutrophilum V24Sta]
Sequence
MRVVVGIDDTDSHRGGCTTYVGYLLAKEVLRRWGAGAFRDFPRLVRLNPNVPFKTRGNAA
VALDLEIPEGDVEELWRLAVETVAAHSRREGKTDPGVAMAAGGVPERAKTLYRMALTQVV
SISAAERAGVLTWGGRGKIGAVAAVGAYFPKSTFELIAYRRGDREAIPPDLVRLLEALTY
PYTFHNVDRRRVLIEPRGPDPVYYGIRGLTPQHLRYALSLLEAWGYRPAGWVIYRTNQAT
DAHIELGVFYGDPLPYSFYRARGLVVEARRVAGRHLVGRLDSGLRFVAYRHLGRLASELE
RCLRCDVVLYGGLKPRRGGLYLYVERAYVLGRYIPARSRCTYCGGSLESLGRGRGWRCRR
CGAVFHSAPIRWLYDTAPRRALLPRPGEWRHLLKPPDVDPTIPNFFSPSSAEWIG
Download sequence
Identical sequences B1YAA9
gi|171184610|ref|YP_001793529.1| 444157.Tneu_0126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]