SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|171184770|ref|YP_001793689.1| from Thermoproteus neutrophilus V24Sta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171184770|ref|YP_001793689.1|
Domain Number 1 Region: 4-207
Classification Level Classification E-value
Superfamily CbiG N-terminal domain-like 2.75e-42
Family CbiG N-terminal domain-like 0.0000784
Further Details:      
 
Domain Number 2 Region: 193-318
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 6.41e-25
Family CobE/GbiG C-terminal domain-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171184770|ref|YP_001793689.1|
Sequence length 319
Comment cobalamin biosynthesis protein CbiG [Pyrobaculum neutrophilum V24Sta]
Sequence
MLELLWRGAAVFYAGAGPPPAAERLVEELKARGVPAHLLNNGMLAEAWGCYDAFIFVEAL
GGVVRLLCPLLRDKERDPPVLVVEREGRFVIPLVGSHRGANELARELAEMLGGVAVVTTA
VDAAGAHPAEDFERYMLCDMGREGRLLVNKALKEGRRVCVEGGRLPPYLRGYAEGGGCDV
VIKLGEGCGPGEVCCRPAALYVGVGARSEATPAEVAEAVKKALEAVGVGLDRVAAVASIK
PVALKAAEALGVKAVLYSPEELREGAASPCLSPPSQKALEAVGLPGVAELAALKAAGEGG
RLIYRKRAAGGVTVAIAAR
Download sequence
Identical sequences B1YBB2
444157.Tneu_0291 gi|171184770|ref|YP_001793689.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]