SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|171185222|ref|YP_001794141.1| from Thermoproteus neutrophilus V24Sta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171185222|ref|YP_001794141.1|
Domain Number 1 Region: 38-126
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.000000227
Family Multidrug-binding domain of transcription activator BmrR 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171185222|ref|YP_001794141.1|
Sequence length 126
Comment hypothetical protein Tneu_0756 [Pyrobaculum neutrophilum V24Sta]
Sequence
MAKIEVKDVQEVRGFSVVKRVTNRAALFADLKQNAVFIFHGKEGQELVFEIFTPDPNGDK
VLPASKVASTKFTGSAEKVDNAYATLLFWALKEGKTLGTPIREVYTKVDTKQSPPEVEVE
VQAPVQ
Download sequence
Identical sequences B1YD32
444157.Tneu_0756 gi|171185222|ref|YP_001794141.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]