SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|171185930|ref|YP_001794849.1| from Thermoproteus neutrophilus V24Sta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171185930|ref|YP_001794849.1|
Domain Number 1 Region: 25-82,113-225
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 4.45e-43
Family NADH oxidase/flavin reductase 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171185930|ref|YP_001794849.1|
Sequence length 235
Comment nitroreductase [Pyrobaculum neutrophilum V24Sta]
Sequence
MRKAARGGLYEVLLPFPRLRGSISLEEALANRRSVREFSDDPITLEELGQLLWATYGISE
VRHGFRTAPSAGALYPLEIYAVVGERGVAYGGGFLEAGVYHYDVYRHSLVLRRRGDFREA
LYRAALEQDWVLAAPLSIVIAAVYQRTARVYGERGRVRYVPMDVGHAGQNLYLQAVALGL
GTVAVGAFDDGAVAEALGLPPEETPLYIMPVGRPRVPYRLEEEDLRAFYSARRSS
Download sequence
Identical sequences B1Y9H4
gi|171185930|ref|YP_001794849.1| 444157.Tneu_1478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]