SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|171185942|ref|YP_001794861.1| from Thermoproteus neutrophilus V24Sta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171185942|ref|YP_001794861.1|
Domain Number 1 Region: 8-42
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000000000962
Family Ribonuclease PH domain 1-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171185942|ref|YP_001794861.1|
Sequence length 50
Comment exosome complex exonuclease Rrp41 [Pyrobaculum neutrophilum V24Sta]
Sequence
MKKPPVPLLQGGVRADGRAPDQMREVQISVGVISNADGSAMVPHYAHERL
Download sequence
Identical sequences B1Y9I6
444157.Tneu_1491 gi|171185942|ref|YP_001794861.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]