SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|182412850|ref|YP_001817916.1| from Opitutus terrae PB90-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|182412850|ref|YP_001817916.1|
Domain Number - Region: 264-289
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.0412
Family Intron-encoded homing endonucleases 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|182412850|ref|YP_001817916.1|
Sequence length 443
Comment HNH endonuclease [Opitutus terrae PB90-1]
Sequence
MPKPTINFIRGKVSSEARARFDEIWHYRLTENQWPTDRWNYKRLPKPKFDALLKSLNGAY
IVEMDSSGTKTYELQPIGVLCTSDGDRYLKLLRRFVEYLRHVYFDNDRQNSIQHSELINH
AGFTSAESAELGRLLYVSRILGVACGGQPDFSAWSTSLPSDLGGILPSEGPTDEAFEILI
LRDWHPHWPISYEERARQLHSGSASVLKHLLDVASTAPAPKRKEPARKRAHVPAATETKV
LAASRRRCAFCFGLNGVLEETEGQIAHIDHDPKNAKPENLVWLCSKHHNSYDSSMSQVKG
YTAGELRLFRAELRKAIERKEHLSAPKSAPAAISGAAPQLPYEPQLKSSPREAVLAAWKD
VQRAAIGVLETKMAFPDKTAPIPTGALITMLRNFGGVDQANATAIGQLASIHDAIAGGAA
VDESTARAYCDAAEPVIAYLMAK
Download sequence
Identical sequences B1ZXT2
452637.Oter_1028 WP_012373854.1.87878 gi|182412850|ref|YP_001817916.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]