SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|167622299|ref|YP_001672593.1| from Shewanella halifaxensis HAW-EB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167622299|ref|YP_001672593.1|
Domain Number 1 Region: 33-104
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.00000994
Family Coronavirus S2 glycoprotein 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|167622299|ref|YP_001672593.1|
Sequence length 215
Comment hypothetical protein Shal_0358 [Shewanella halifaxensis HAW-EB4]
Sequence
MKKLITTTILGTSLLLGGCQSAYYGAMEKVGYHKRDIMVDRVEDAKESQEEAQEQFSSAL
EEMQALLNHDGGDLESAYNKAKDEYESAQDAADDVTNRIDKVEDVAEALFDEWQTEIGEI
SKASLRRNSESKLRETERSYTQLVKSMRRAESKMEPVLVAMKDNMLYLKHNLNAQAIGAI
KGEFASLQTDISGLIKEMNKSINESNKFIASLEGK
Download sequence
Identical sequences B0TPR3
gi|167622299|ref|YP_001672593.1| 458817.Shal_0358 WP_012275489.1.86919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]