SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|167625172|ref|YP_001675466.1| from Shewanella halifaxensis HAW-EB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167625172|ref|YP_001675466.1|
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.1e-43
Family SMI1/KNR4-like 0.00000552
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|167625172|ref|YP_001675466.1|
Sequence length 134
Comment hypothetical protein Shal_3260 [Shewanella halifaxensis HAW-EB4]
Sequence
MNDIIEQLQEMSETVPVPLELATFEQIVEVEEEILIPLPMELKEYLLYASDVICGSLEPV
TASDPHSHTYLSEVAAYAWSIGLPREFVPICQQGDNFFFISQEGQIQLWQDGEIDEEETW
ESFWEWAEDVWMRS
Download sequence
Identical sequences B0TR76
458817.Shal_3260 WP_012278329.1.86919 gi|167625172|ref|YP_001675466.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]