SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|167625591|ref|YP_001675885.1| from Shewanella halifaxensis HAW-EB4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|167625591|ref|YP_001675885.1|
Domain Number - Region: 33-103
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.0188
Family Coronavirus S2 glycoprotein 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|167625591|ref|YP_001675885.1|
Sequence length 118
Comment hypothetical protein Shal_3685 [Shewanella halifaxensis HAW-EB4]
Sequence
MEWALTLAAFVIGGVFGYVGHTLLAKNNRHKNNNEQLEQTQLELSQYKQEVSDHFDDHYK
QLAELTAQLNRVNQQWNASANSFTYPVTEKQLPELKVQASEKPDEIAEELKEQQPIPT
Download sequence
Identical sequences B0TUV9
458817.Shal_3685 gi|167625591|ref|YP_001675885.1| WP_012278744.1.86919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]