SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|169236391|ref|YP_001689591.1| from Halobacterium salinarum R1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169236391|ref|YP_001689591.1|
Domain Number 1 Region: 126-206
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.55e-20
Family Translational machinery components 0.0024
Further Details:      
 
Domain Number 2 Region: 42-113
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.46e-19
Family Ribosomal S5 protein, N-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|169236391|ref|YP_001689591.1|
Sequence length 212
Comment 30S ribosomal protein S5P [Halobacterium salinarum R1]
Sequence
MSYNDTWQPKTRLGGLVQDGEVEDMSEALDTGLPLKEPEIVDQLLPGLDDEVLDINMVQR
MTDSGRRVKFRCVVAIGNRDGYVGYAEGRDDQVGGAIQKAIEVAKLNIIDVSRGCGSWEC
GCGRPHTVALKSTGKAGSVDVELMPAPRGLGLAGGETVQHVLELAGIDDVWTRSSGKTRT
TVNFAKATFNALRETSEARVPQHAREEREVIE
Download sequence
Identical sequences B0R676 Q9HPB4
gi|169236391|ref|YP_001689591.1| WP_010903254.1.1784 WP_010903254.1.50382 gi|15790652|ref|NP_280476.1| 478009.OE3415F 64091.VNG1715G

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]