SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|169236860|ref|YP_001690060.1| from Halobacterium salinarum R1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169236860|ref|YP_001690060.1|
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-34
Family YigZ N-terminal domain-like 0.00041
Further Details:      
 
Domain Number 2 Region: 144-205
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.0000000671
Family YigZ C-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|169236860|ref|YP_001690060.1|
Sequence length 206
Comment hypothetical protein OE4224F [Halobacterium salinarum R1]
Sequence
MTDAYRTLAGSGRDSFEVRGSEFIGYAGPANTVAAAEAFIQEVRERHADATHNVPWYRVR
VTGGGPGGGHLLREYQSDDGEPTGSAGKPALNVVQQRDVENVVGVVTRYYGGTNLGVGGL
ARAYSTAVKDAVDAAGVVTQRPQARLVVTVAYDDSGTVRGILESAECSFDADYEADVTFE
VTVAVADADALRERIADATSGRAEIS
Download sequence
Identical sequences B0R7J5
gi|169236860|ref|YP_001690060.1| 478009.OE4224F 64091.VNG2298a WP_010903713.1.1784 WP_010903713.1.50382 gi|16554514|ref|NP_444238.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]