SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|169236908|ref|YP_001690108.1| from Halobacterium salinarum R1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169236908|ref|YP_001690108.1|
Domain Number 1 Region: 63-225,353-492
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.04e-47
Family Tandem AAA-ATPase domain 0.0000435
Further Details:      
 
Domain Number 2 Region: 568-700
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 2.28e-27
Family XPF/Rad1/Mus81 nuclease 0.000053
Further Details:      
 
Domain Number 3 Region: 711-778
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0000000000000826
Family Hef domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|169236908|ref|YP_001690108.1|
Sequence length 784
Comment Hef nuclease [Halobacterium salinarum R1]
Sequence
MSEEMGYVDHPMLADGVIEARQYQLQLAAAARQGHTLVCLPTGLGKTTVSLLVTAYRLAD
DAGGTALLLAPTKPLVEQHAGFYREALAIPDDDVVVFTGETRPDDRRAAWTDARVVVATP
QVVENDLVGGRIDMDDVVHCTFDECHRATGDYAYTYVAERYHADAAAPLVTAMSASPGGT
EAEIRTVCENLGVGNVEVMTEDDADVGEHTHDTDVQWERVTLPEEILEVRDAINDVIEDR
LAKLREIGVTKASSPDISQKDLNEIRARLQQLIDDDDSDGYQGMSVHAEVMKLKRAVELV
ETQSVESVRRYFERQRNAANTAGASKASQRLVSEPAVKRAMRTAREFDGLHPKFRQARML
LAETLGIEDGDRVIVFTESRDTAEALTAFLGEHFDTRRFVGQGDADGSDGMTQTEQRETL
AEFRNGDFEVLVSTSVAEEGLDVPEVDLVLFFEPVPTAIRSVQRKGRTGRQTAGRVVVLL
AEDTRDEAYFWISRRREQEMTEELQSLKGRADELETELGGDGAQQALDEFGDAEAAGEEP
AAPAPEDVSDGEDTEGVAARVDGAGEAVEVVVDQRELDSTIARELSKRDGVETRLETLAV
GDYVVSDRVAVERKSHSDFMDTLLGSERSIFEQAKELARQYTRPVLVVEGDGDLYAERNV
HPNAVRSAMASLAVDWGLSVMHTNGEGDTTEMIETIAEREQTTNDRAVSAHGEKAAKTQG
EQQEYVVSSITDVGPVTARSLLDTFGSVEAVMTASEDELTAADGVGAVTAERIRGVVGTE
YQPE
Download sequence
Identical sequences B0R7P3 Q9HMW5
gi|169236908|ref|YP_001690108.1| WP_010903758.1.1784 WP_010903758.1.50382 gi|15791152|ref|NP_280976.1| 478009.OE4310F 64091.VNG2356G

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]