SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|169834914|ref|YP_001715702.1| from Clostridium botulinum A3 str. Loch Maree

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169834914|ref|YP_001715702.1|
Domain Number 1 Region: 1-476
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.3e-160
Family Clostridium neurotoxins, catalytic domain 0.0000885
Further Details:      
 
Domain Number 2 Region: 465-796
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 2.62e-121
Family Clostridium neurotoxins, "coiled-coil" domain 0.00037
Further Details:      
 
Domain Number 3 Region: 806-988
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.53e-37
Family Clostridium neurotoxins, the second last domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|169834914|ref|YP_001715702.1|
Sequence length 1159
Comment botulinum neurotoxin type A3 nontoxic-nonhemagglutinin subunit [Clostridium botulinum A3 str. Loch Maree]
Sequence
MKINNNFNIDSPVDNKDVAIVRGRKTDTFFKVFQVAPNIWVAPERYYGESLNINEDQKSD
GGIYDSNFLLTNDEKDEFLEATVKILQRINNNVVGAKLLSLISTAIPFPYEYKPGDYRQT
NYLVSKDNQHYYTANLVIFGPGANIVENNAVYYKKEDSENGMGTISEIWFQPFLTYKYDQ
FYVDPALELIKCLIKSLYYLYGIKPSDDLSIPCRLRSEFNSLEYSELDMVDFLISGGTEY
KLLDTNPYWFTDNYFIDAPKNFEKYKNDYETKIKNNNDIANSIKLYLEQKFKINAQDIWE
LNLSYFSTEFEIMMPEIFNNALNHYYRKEYYVIDYFKNYNINGFINGQIKTILPLSKYNK
NITNKPELVVNLINENNTVLMKSNVYGDGLKGTMDNFYAAYKIPYNIGDEYHINYSYLNN
VSVEEINNIPPINDADIYPYRKNSDPFIPVYNITETKEINTTTPFSVNYLQAQVTNSNDI
SLSSDFSKVVSSKDRSLVYSFLDNTIDYLDSIKYDGPIDTDKKYYLWLKEIFRNYSFDMT
ETQEVNTPCGINKVVPWLGKALNILNTGNSFIEEFKSLGPISLINKKENITMPKIGIDEI
PNSMLNLSFKDLSENLFNIFFKNNSYFEKIYYDFLDQWWTQYYSQYFDLICMAKRSVLAQ
ESLIKKIIQKKLSYLIGNANISSDNLALMNLTTTNTLRDISNESQIAMNNVDSFLNDAAI
CVFESNIYPKFISFMEQCINNINKDTKEFIQKCINITENEKLQLISQNTFSSLDFDFLNI
ENLKSLFSSETALLIKEETSPYELVLYAFQELSNNVIGDASGKNTSIEYSKDIGLVYGIN
SDALYLNGSNQSISFSNDFFENGLTNSFSIYFWLRNLGQDTTKSKLIGSKEDNCGWEIYF
QDTGLVFNMIDSNGDEKNIYLSDVSNNSWHYITISVDRLKEQLLIFIDDNLVVNESIKEI
LNIYSSNIISLLSDNNASYIEGLTILNKPTTGEEVLSNYFKNLNNSYIRDSNEERLEYNK
TYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQYVQKFDEAII
SILDNMEKYIDISEDNRLQLIDNKNSAKKMLISNDIFISNCLTLSYNGKYICLSMKDENY
NWMICNNDMSKYLYLWSFK
Download sequence
Identical sequences B1L2G4
498214.CLK_A0075 gi|169834914|ref|YP_001715702.1|NC_010418 WP_012300955.1.9908 gi|169834914|ref|YP_001715702.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]