SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|169835008|ref|YP_001715703.1| from Clostridium botulinum A3 str. Loch Maree

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169835008|ref|YP_001715703.1|
Domain Number 1 Region: 2-542
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.16e-175
Family Clostridium neurotoxins, catalytic domain 0.000000000000031
Further Details:      
 
Domain Number 2 Region: 545-870
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 3.53e-111
Family Clostridium neurotoxins, "coiled-coil" domain 0.0000000000847
Further Details:      
 
Domain Number 3 Region: 1076-1289
Classification Level Classification E-value
Superfamily STI-like 3.66e-78
Family Clostridium neurotoxins, C-terminal domain 0.0000000031
Further Details:      
 
Domain Number 4 Region: 871-1075
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.13e-49
Family Clostridium neurotoxins, the second last domain 0.000000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|169835008|ref|YP_001715703.1|
Sequence length 1292
Comment botulinum neurotoxin type A3 [Clostridium botulinum A3 str. Loch Maree]
Sequence
MPFVNKQFNYRDPVNGVDIAYIKIPNAGQMQPVKAFKIHEGVWVIPERDTFTNPEEGDLN
PPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVIKLFDRIYSTGLGRMLLSFIVKGIPFWGG
STIDTELKVIDTNCINVIEPGGSYRSEELNLVITGPSADIIQFECKSFGHDVFNLTRNGY
GSTQYIRFSPDFTFGFEESLEVDTNPLLGAGTFATDPAVTLAHELIHAAHRLYGIAINPN
RVLKVKTNAYYEMSGLEVSFEELRTFGGNDTNFIDSLWQKKFSRDAYDNLQNIARILNEA
KTIVGTTTPLQYMKNIFIRKYFLSEDASGKISVNKAAFKEFYRVLTRGFTELEFVNPFKV
INRKTYLNFDKAVFRINIVPDENYTINEGFNLEGANSNGQNTEINSRNFTRLKNFTGLFE
FYKLLCVRGIIPFKTKSLDEGYNKALNDLCIKVNNWDLFFSPSEDNFTNDLDKVEEITAD
TNIEAAEENISSDLIQQYYLTFDFDNEPENISIENLSSDIIGQLEPMPNIERFPNGKKYE
LDKYTMFHYLRAQEFEHGDSRIILTNSAEEALLKPNVAYTFFSSKYVKKINKAVEAVIFL
SWAEELVYDFTDETNEVTTMDKIADITIIVPYIGPALNIGNMVSKGEFVEAILFTGVVAL
LEFIPEYSLPVFGTFAIVSYIANKVLTVQTINNALSKRNEKWDEVYKYTVTNWLAKVNTQ
IDLIREKMKKALENQAEATRAIINYQYNQYTEEEKNNINFNIDDLSSKLNRSINRAMINI
NKFLDQCSVSYLMNSMIPYAVKRLKDFDASVRDVLLKYIYDNRGTLILQVDRLKDEVNNT
LSADIPFQLSKYVNDKKLLSTFTEYIKNIVNTSILSIVYKKDDLIDLSRYGAKINIGDRV
YYDSIDKNQIKLINLESSTIEVILKNAIVYNSMYENFSTSFWIKIPKYFSKINLNNEYTI
INCIENNSGWKVSLNYGEIIWTLQDNKQNIQRVVFKYSQMVNISDYINRWMFVTITNNRL
TKSKIYINGRLIDQKPISNLGNIHASNKIMFKLDGCRDPRRYIMIKYFNLFDKELNEKEI
KDLYDSQSNPGILKDFWGNYLQYDKPYYMLNLFDPNKYVDVNNIGIRGYMYLKGPRGSVM
TTNIYLNSTLYMGTKFIIKKYASGNEDNIVRNNDRVYINVVVKNKEYRLATNASQAGVEK
ILSALEIPDVGNLSQVVVMKSKDDQGIRNKCKMNLQDNNGNDIGFVGFHLYDNIAKLVAS
NWYNRQVGKASRTFGCSWEFIPVDDGWGESSL
Download sequence
Identical sequences B1L2G5 D3IV24
gi|169835008|ref|YP_001715703.1| gi|169835008|ref|YP_001715703.1|NC_010418 498214.CLK_A0076 WP_012301031.1.9908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]