SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170760800|ref|YP_001787260.1| from Clostridium botulinum A3 str. Loch Maree

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|170760800|ref|YP_001787260.1|
Domain Number - Region: 256-286,358-455,499-678
Classification Level Classification E-value
Superfamily ARM repeat 0.0199
Family HEAT repeat 0.069
Further Details:      
 
Domain Number - Region: 69-159
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0418
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0096
Further Details:      
 
Domain Number - Region: 794-869
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.0497
Family Clostridium neurotoxins, "coiled-coil" domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170760800|ref|YP_001787260.1|
Sequence length 889
Comment phage protein [Clostridium botulinum A3 str. Loch Maree]
Sequence
MADGRIIIDTQIDNKGAEKGINELNGIANKGLKGIGIAIAGVGTAMGTMGGFALKTGVDF
ESAFTGVKKTVDGTDQQFTQLEKAIRNMAKSMPESASEIAGVAEAAGQLGIKVENIEGFT
KSMVMLGDSTNMSSEEAATALARLANITQMPQTQFDRLGSVIVALGNNLATTESEITAMG
LRLAGAGHQVGMSEAQIMSFAGALSSVGIEAEAGGSAFSKVMVDMQLAVEKGGEGLNQFA
KVAGMSSSEFQKAFKEDAAGAIIAFIQGLGKCQESGQSAIGVLDDMGITEVRMRDALLRA
AGAGNIFTDALELGTKAWEENTALANEANQRYDTTESKMKMIKNSVVDLGIAMFDKFREP
FRESLDTVMESLSNLSDSLANGSLGESVDRLAEGFGNFISRVAEGVENWLPKIINALAWI
MDNASFIASGIAGIGAALLTLKIASIVGTIAEKFKLLYLEIATGTPIMEAFNIVLGLNPI
ILITAAVIGFIAALVILWNTNEGFRNAVIGAWNAISGAAQAVWGAIVDFFTVDIPAAWQS
LLDFFSGVPGWFADLWATIQQAFVDGWNTIVNFFTQTIPQWIDSVGKWFNELPHLIGYAL
GYALGTIVKWGIDTWNYLSTNVPIWINNVVNFFATLPGRIWTWLVNTINRIVNWGQQTYT
NMVNAATRAINATIQWFSQLPGRIWTWLVNTISRVAQFAVNLANTARTAGANMVTNIISA
VANLPSQFVNIGKNIVQGVWNGITGMAGWIRDRVNGFFSGIVDGAKDALGIHSPSRVFRD
QVGKYMAQGVGVGFENETENIKKSMQKDLSNLTAKMKTTVDFETSKTSRAMTAGVNKTIN
NTNETVTNNDNGLTLKVDKFINNTKQDIKDIAEELEFYRKRNSLATGGV
Download sequence
Identical sequences B1KTU5
498214.CLK_1322 WP_012344097.1.9908 gi|170760800|ref|YP_001787260.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]